Difference between revisions of "Os03g0180800"
| Line 1: | Line 1: | ||
| − | + | The rice gene ''Os03g0180800'' was reported as '''''OsTIFY11a''''' in 2008<ref name="ref1"/>, a '''JA signaling gene''' and '''''ZIM-3''''' in 2013<ref name="ref2"/>, '''''OsJAZ3''''' in 2013<ref name="ref3"/><ref name="ref4"/>, respectively. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | *For ''OsTIFY11a'', the PCR products were '''cloned into''' p1301H (modified based on pCAMBIA1301) which has the stress-inducible promoter of ''OsLEA3-I''<ref name="ref1"/><ref name="ref5"/>. | |
| + | |||
| + | *JA signaling gene ''Os03g0180800'' was '''up-regulated''' by '''FA exposure'''<ref name="ref2"/>. Overexpression of '''''ZIM-3''''' (''Os03g0180800''), a stress-inducible gene, was found to significantly '''increase tolerance''' to '''salt and dehydration stresses'''<ref name="ref1"/><ref name="ref2"/>. | ||
| + | |||
| + | ===Mutation=== | ||
| + | (non) over-expressed lines<ref name="ref1"/>: | ||
| + | *four ''OsTIFY11a'' over-expressed lines: | ||
| + | **H6 | ||
| + | **H8 | ||
| + | **H10 | ||
| + | **H13 | ||
| + | *four non over-expressed lines: | ||
| + | **H2 | ||
| + | **H3 | ||
| + | **H7 | ||
| + | **H11 | ||
| + | *the over-expression of transgenic lines showed significantly '''increased tolerance''' to the stress treatments in terms of the '''shoot growth'''. | ||
| + | *''OsTIFY11a''-overexpressed lines '''accumulated''' significantly '''higher content''' of '''proline''' than the nonover-expressed lines under the '''salt stress''' conditions. | ||
| + | *When the seeds of ''OsTIFY11a'' transgenic plants were germinated on MS medium containing 75 mM NaCl, the over-expressed transgenic seeds had a significantly '''higher germination rate''' than the non-overexpressed transgenic seeds, '''but''' they showed '''no difference''' in germination rate on the normal MS medium. | ||
===Expression=== | ===Expression=== | ||
| − | + | *The full length cDNA of ''OsTIFY11a'' for overexpression was '''isolated from''' ''indica'' rice Minghui 63 and '''encodes''' a protein with the sequence as from ''japonica'' rice. ''OsTIFY11a'' and ''OsTIFY11e'' had '''similar induction dynamics''': the induced expression peaked at 0.5 h after '''JA treatment'''<ref name="ref1"/>. | |
| + | |||
| + | *Over-expression of ''OsTIFY11a'', one of the '''stress-inducible genes''', resulted in significantly '''increased tolerance''' to '''salt and dehydration stresses'''. The ''OsTIFY11a'' gene was expressed in the 3–5 cm '''young panicles''' at a relatively '''high''' level. Interestingly, almost all of the ''OsTIFY'' genes with a '''high expression level''' in '''leaves''' had a very '''low expression level''' in the '''stamen'''<ref name="ref1"/>. | ||
| + | |||
| + | ===Subcellular localization=== | ||
| + | The transient gene expression assay using ''Arabidopsis'' mesophyll protoplasts showed that the ''OsTIFY11a''-GFP fusion protein was colocalized with the reported rice transcription factor Ghd7 in the '''nucleus''', suggesting that ''OsTIFY11a'' is '''a nuclear protein'''<ref name="ref1"/>. | ||
===Evolution=== | ===Evolution=== | ||
| − | + | *A few ''OsTIFY'' gene clusters, including two OsTIFY gene clusters (''OsTIFY11a'', ''OsTIFY11b'', and O''sTIFY11c''; ''OsTIFY11g'' and ''OsTIFY10a''), on chromosome 3 and one gene cluster (''OsTIFY11e'', ''OsTIFY11f'', and ''OsTIFY11d'') on chromosome 10<ref name="ref1"/>. | |
| + | |||
| + | *''OsTIFY11a'' contains '''a TIFY domain''' and '''a Jas motif''', but two amino acids (Pro and Tyr) that were identified in the Jas motif are absent in ''OsTIFY11a''<ref name="ref1"/>. | ||
| − | + | ===Knowledge Extension=== | |
| + | The '''TIFY family''' is a novel plant-specific gene family involved in the regulation of diverse plant-specific biologic processes, such as development and responses to phytohormones, in ''Arabidopsis''. However, there is limited information about this family in monocot species<ref name="ref1"/>. | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | *National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, 430070 Wuhan, China | |
==References== | ==References== | ||
| − | + | <references> | |
| + | * <ref name="ref1"> | ||
| + | Ye H, Du H, Tang N, et al. Identification and expression profiling analysis of TIFY family genes involved in stress and phytohormone responses in rice[J]. Plant molecular biology, 2009, 71(3): 291-305. | ||
| + | </ref> | ||
| + | * <ref name="ref2"> | ||
| + | Chi W C, Chen Y A, Hsiung Y C, et al. Autotoxicity mechanism of Oryza sativa: transcriptome response in rice roots exposed to ferulic acid[J]. BMC genomics, 2013, 14(1): 351. | ||
| + | </ref> | ||
| + | * <ref name="ref3"> | ||
| + | Lee H Y, Seo J S, Cho J H, et al. Oryza sativa COI homologues restore jasmonate signal transduction in Arabidopsis coi1-1 mutants[J]. PloS one, 2013, 8(1): e52802. | ||
| + | </ref> | ||
| + | * <ref name="ref4"> | ||
| + | Shimizu T, Miyamoto K, Miyamoto K, et al. OsJAR1 contributes mainly to biosynthesis of the stress-induced jasmonoyl-isoleucine involved in defense responses in rice[J]. Bioscience, biotechnology, and biochemistry, 2013, 77(7): 1556-1564. | ||
| + | </ref> | ||
| + | * <ref name="ref5"> | ||
| + | Xiao B, Huang Y, Tang N, et al. Over-expression of a LEA gene in rice improves drought resistance under the field conditions[J]. Theoretical and Applied Genetics, 2007, 115(1): 35-46. | ||
| + | </ref> | ||
| + | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 07:17, 2 March 2015
The rice gene Os03g0180800 was reported as OsTIFY11a in 2008[1], a JA signaling gene and ZIM-3 in 2013[2], OsJAZ3 in 2013[3][4], respectively.
Contents
Annotated Information
Function
- For OsTIFY11a, the PCR products were cloned into p1301H (modified based on pCAMBIA1301) which has the stress-inducible promoter of OsLEA3-I[1][5].
- JA signaling gene Os03g0180800 was up-regulated by FA exposure[2]. Overexpression of ZIM-3 (Os03g0180800), a stress-inducible gene, was found to significantly increase tolerance to salt and dehydration stresses[1][2].
Mutation
(non) over-expressed lines[1]:
- four OsTIFY11a over-expressed lines:
- H6
- H8
- H10
- H13
- four non over-expressed lines:
- H2
- H3
- H7
- H11
- the over-expression of transgenic lines showed significantly increased tolerance to the stress treatments in terms of the shoot growth.
- OsTIFY11a-overexpressed lines accumulated significantly higher content of proline than the nonover-expressed lines under the salt stress conditions.
- When the seeds of OsTIFY11a transgenic plants were germinated on MS medium containing 75 mM NaCl, the over-expressed transgenic seeds had a significantly higher germination rate than the non-overexpressed transgenic seeds, but they showed no difference in germination rate on the normal MS medium.
Expression
- The full length cDNA of OsTIFY11a for overexpression was isolated from indica rice Minghui 63 and encodes a protein with the sequence as from japonica rice. OsTIFY11a and OsTIFY11e had similar induction dynamics: the induced expression peaked at 0.5 h after JA treatment[1].
- Over-expression of OsTIFY11a, one of the stress-inducible genes, resulted in significantly increased tolerance to salt and dehydration stresses. The OsTIFY11a gene was expressed in the 3–5 cm young panicles at a relatively high level. Interestingly, almost all of the OsTIFY genes with a high expression level in leaves had a very low expression level in the stamen[1].
Subcellular localization
The transient gene expression assay using Arabidopsis mesophyll protoplasts showed that the OsTIFY11a-GFP fusion protein was colocalized with the reported rice transcription factor Ghd7 in the nucleus, suggesting that OsTIFY11a is a nuclear protein[1].
Evolution
- A few OsTIFY gene clusters, including two OsTIFY gene clusters (OsTIFY11a, OsTIFY11b, and OsTIFY11c; OsTIFY11g and OsTIFY10a), on chromosome 3 and one gene cluster (OsTIFY11e, OsTIFY11f, and OsTIFY11d) on chromosome 10[1].
- OsTIFY11a contains a TIFY domain and a Jas motif, but two amino acids (Pro and Tyr) that were identified in the Jas motif are absent in OsTIFY11a[1].
Knowledge Extension
The TIFY family is a novel plant-specific gene family involved in the regulation of diverse plant-specific biologic processes, such as development and responses to phytohormones, in Arabidopsis. However, there is limited information about this family in monocot species[1].
Labs working on this gene
- National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, 430070 Wuhan, China
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Ye H, Du H, Tang N, et al. Identification and expression profiling analysis of TIFY family genes involved in stress and phytohormone responses in rice[J]. Plant molecular biology, 2009, 71(3): 291-305.
- ↑ 2.0 2.1 2.2 Chi W C, Chen Y A, Hsiung Y C, et al. Autotoxicity mechanism of Oryza sativa: transcriptome response in rice roots exposed to ferulic acid[J]. BMC genomics, 2013, 14(1): 351.
- ↑ Lee H Y, Seo J S, Cho J H, et al. Oryza sativa COI homologues restore jasmonate signal transduction in Arabidopsis coi1-1 mutants[J]. PloS one, 2013, 8(1): e52802.
- ↑ Shimizu T, Miyamoto K, Miyamoto K, et al. OsJAR1 contributes mainly to biosynthesis of the stress-induced jasmonoyl-isoleucine involved in defense responses in rice[J]. Bioscience, biotechnology, and biochemistry, 2013, 77(7): 1556-1564.
- ↑ Xiao B, Huang Y, Tang N, et al. Over-expression of a LEA gene in rice improves drought resistance under the field conditions[J]. Theoretical and Applied Genetics, 2007, 115(1): 35-46.
Structured Information
| Gene Name |
Os03g0180800 |
|---|---|
| Description |
ZIM domain containing protein |
| Version |
NM_001055701.1 GI:115451130 GeneID:4331832 |
| Length |
1035 bp |
| Definition |
Oryza sativa Japonica Group Os03g0180800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:4210340..4211374 |
| Sequence Coding Region |
4210735..4211274 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:4210340..4211374 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:4210340..4211374 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgtcgacggatcccatgacccgccgcttcgccgtcgcgtgcggcgtgctcagccagtacgtcaaggccaactcctcgcagccgtcgacggcggcgccggtggctcaaggtgtgagtggcctcatggccgccgccgccgccgccgccgcggcgcctgtggtccaggaacccggatgcgaggtggacggcggggggcagcagttcacgatcttctacgccgggaaggtggtggtgatcgaccgctgcacgccggccatggcggccgagctgatgcggttcgcgtcggcggcgcagggcggcggcggcgcgccagaggcgccgcccgcgctggtggacatgccgatcgcgaggaaggcgtcgctgaagcggttcctggcgaagcgcaaggccacccccgcctccgcgcggtcgtcgtacgtcgtccgtgctgcggcggcggaggaggagcagccgccggcgaagaaagcgaaggcggccgtggagaggcgcgaggattggctcgcgctgggaagccttggacacatgcactcgcgctga</cdnaseq> |
| Protein Sequence |
<aaseq>MASTDPMTRRFAVACGVLSQYVKANSSQPSTAAPVAQGVSGLMA AAAAAAAAPVVQEPGCEVDGGGQQFTIFYAGKVVVIDRCTPAMAAELMRFASAAQGGG GAPEAPPALVDMPIARKASLKRFLAKRKATPASARSSYVVRAAAAEEEQPPAKKAKAA VERREDWLALGSLGHMHSR</aaseq> |
| Gene Sequence |
<dnaseqindica>101..640#atatgtgatcagcgacgtacagtacagatcgttcgcaataaagttagacttctcgtctctctttgtgcttgtgcttagttgtccgtgctagaagacggcaatggcgtcgacggatcccatgacccgccgcttcgccgtcgcgtgcggcgtgctcagccagtacgtcaaggccaactcctcgcagccgtcgacggcggcgccggtggctcaaggtgtgagtggcctcatggccgccgccgccgccgccgccgcggcgcctgtggtccaggaacccggatgcgaggtggacggcggggggcagcagttcacgatcttctacgccgggaaggtggtggtgatcgaccgctgcacgccggccatggcggccgagctgatgcggttcgcgtcggcggcgcagggcggcggcggcgcgccagaggcgccgcccgcgctggtggacatgccgatcgcgaggaaggcgtcgctgaagcggttcctggcgaagcgcaaggccacccccgcctccgcgcggtcgtcgtacgtcgtccgtgctgcggcggcggaggaggagcagccgccggcgaagaaagcgaaggcggccgtggagaggcgcgaggattggctcgcgctgggaagccttggacacatgcactcgcgctgatgatcatcgccacgacgtcacgtctgcgatttgagaattgagagctcgatcgattgatcgccatgtggtcacccggtagccgatgctgcaaggccggtcgagttggaagatggttctcgtcgcattaacggccttgagttgatttcgccgagcctgaccttgagttgattaccatggaagtatgaagatttcgtgattagcagttaccctagttatcgcggcgtataattaagcacggtcactgaagcgcaatggccttgagtcggtagatcaggactagagaggggtgtatggatctgacaagtactgtagtatattgtatcccgtttgaattttttttcgattcctatggggactgaattgattaatgatataaaattccttcgactgttctg</dnaseqindica> |
| External Link(s) |
