Difference between revisions of "Os03g0805100"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice gene Os03g0805100 was reported as '''''SQS''''' in 2012<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
It is demonstrated that RNAi-mediated disruption of a rice farnesyltransferase/squalene synthase (SQS) by maize squalene synthase '''improves drought tolerance''' at both the '''vegetative''' and '''reproductive stages'''<ref name="ref1"/>.
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004310 GO:0004310],[http://amigo.geneontology.org/amigo/term/GO:0008610 GO:0008610], [http://amigo.geneontology.org/amigo/term/GO:0009058 GO:0009058], [http://amigo.geneontology.org/amigo/term/GO:0016021 GO:0016021], [http://amigo.geneontology.org/amigo/term/GO:0016740 GO:0016740]
 +
 
 +
===Mutation===
 +
*Twenty-day-old seedlings of wild type (Nipponbare) and seven independent events of transgenic RNAi lines showed no difference in morphology. When subjected to '''water stress''' for a period of 32 d under growth chamber conditions, transgenic positives showed '''delayed wilting''', '''conserved more soil water''', and '''improved recovery'''<ref name="ref1"/>.
 +
 
 +
*When five independent events along with wild-type plants were subjected to drought at the reproductive stage '''under greenhouse conditions''', the transgenic plants '''lost water''' more '''slowly''' compared with the wild type, through reduced stomatal conductance and the retention of high leaf relative water content (RWC). After 28 d of slow progressive soil drying, transgenic plants '''recovered better''' and '''flowered earlier''' than wild-type plants<ref name="ref1"/>.
 +
 
 +
*The yield of water-stressed transgenic positive plants ranged from 14–39% '''higher''' than wild-type plants. When grown in plates with Yoshida’s nutrient solution with 1.2% agar, transgenic positives from three independent events showed '''increased root length''' and an '''enhanced number''' of '''lateral roots'''. The RNAi-mediated inactivation produced '''reduced stomatal conductance''' and '''subsequent drought tolerance'''<ref name="ref1"/>.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
The reduced expression of the SQS gene did not result in any alteration in plant morphology '''except for''' two plants in the event RIFGOCW<ref name="ref1"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File: SQS phylogenic1.jpg|right|thumb|250px|'''Figure 1.''' ''Phylogenetic analysis
 +
of SQS gene done with next generation biology workbench presented in Newick (Phylip) Tree format.(from reference <ref name="ref1"/>).'']]
 +
*The sequence similarity search using BLASTP revealed that rice SQS showed '''87% sequence similarity''' with maize SQS, '''74%''' with soybean SQS, '''72%''' with Medicago truncatulata, and '''70%''' with ''Arabidopsis'' SQS1. There appears to be '''another squalene synthase''' in rice (Os07g0200700) which has '''78% sequence similarity with''' Os03g0805100<ref name="ref1"/>.
  
You can also add sub-section(s) at will.
+
*The tree results revealed that SQS genes of '''monocots''' ('''rice, maize''') are '''more closely related'''. It also indicated that the SQS genes from monocots and dicots form distinct groups, and among dicots the clustering of families is seen (Fig. 1)<ref name="ref1"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Division of Plant Sciences, University of Missouri, Columbia, MO-65211, USA
 +
*Syngenta Biotechnology Inc, Research Triangle Park, NC-27709, USA
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Manavalan L P, Chen X, Clarke J, et al. RNAi-mediated disruption of squalene synthase improves drought tolerance and yield in rice[J]. Journal of experimental botany, 2012, 63(1): 163-175.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 05:43, 4 March 2015

The rice gene Os03g0805100 was reported as SQS in 2012[1].

Annotated Information

Function

It is demonstrated that RNAi-mediated disruption of a rice farnesyltransferase/squalene synthase (SQS) by maize squalene synthase improves drought tolerance at both the vegetative and reproductive stages[1].


GO assignment(s): GO:0004310,GO:0008610, GO:0009058, GO:0016021, GO:0016740

Mutation

  • Twenty-day-old seedlings of wild type (Nipponbare) and seven independent events of transgenic RNAi lines showed no difference in morphology. When subjected to water stress for a period of 32 d under growth chamber conditions, transgenic positives showed delayed wilting, conserved more soil water, and improved recovery[1].
  • When five independent events along with wild-type plants were subjected to drought at the reproductive stage under greenhouse conditions, the transgenic plants lost water more slowly compared with the wild type, through reduced stomatal conductance and the retention of high leaf relative water content (RWC). After 28 d of slow progressive soil drying, transgenic plants recovered better and flowered earlier than wild-type plants[1].
  • The yield of water-stressed transgenic positive plants ranged from 14–39% higher than wild-type plants. When grown in plates with Yoshida’s nutrient solution with 1.2% agar, transgenic positives from three independent events showed increased root length and an enhanced number of lateral roots. The RNAi-mediated inactivation produced reduced stomatal conductance and subsequent drought tolerance[1].

Expression

The reduced expression of the SQS gene did not result in any alteration in plant morphology except for two plants in the event RIFGOCW[1].

Evolution

Figure 1. Phylogenetic analysis of SQS gene done with next generation biology workbench presented in Newick (Phylip) Tree format.(from reference [1]).
  • The sequence similarity search using BLASTP revealed that rice SQS showed 87% sequence similarity with maize SQS, 74% with soybean SQS, 72% with Medicago truncatulata, and 70% with Arabidopsis SQS1. There appears to be another squalene synthase in rice (Os07g0200700) which has 78% sequence similarity with Os03g0805100[1].
  • The tree results revealed that SQS genes of monocots (rice, maize) are more closely related. It also indicated that the SQS genes from monocots and dicots form distinct groups, and among dicots the clustering of families is seen (Fig. 1)[1].

Labs working on this gene

  • Division of Plant Sciences, University of Missouri, Columbia, MO-65211, USA
  • Syngenta Biotechnology Inc, Research Triangle Park, NC-27709, USA

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Manavalan L P, Chen X, Clarke J, et al. RNAi-mediated disruption of squalene synthase improves drought tolerance and yield in rice[J]. Journal of experimental botany, 2012, 63(1): 163-175.

Structured Information

Gene Name

Os03g0805100

Description

Similar to Squalene synthase (EC 2.5.1.21)

Version

NM_001058160.1 GI:115456048 GeneID:4334492

Length

7122 bp

Definition

Oryza sativa Japonica Group Os03g0805100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:34455998..34463119

Sequence Coding Region

34456290..34456472,34456597..34456639,34456834..34456923,34457028..34457103,34457780..34457849
,34458833..34458976,34459063..34459167,34459605..34459751,34461103..34461178
,34461835..34461923,34462287..34462378,34462460..34462499,34462584..34462640

Expression

GEO Profiles:Os03g0805100

Genome Context

<gbrowseImage1> name=NC_008396:34455998..34463119 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:34455998..34463119 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggggtgctgtcgaggccggaggaggtgttgccgctggtgaagctgcgggtggcggcggggcggatcaagcggcagatcccgccggaggagcactgggccttcgcctacaccatgctgcagagggtctcccggagcttcgcgctcgtcatccagcagctcggccccgacctccgcaatgccgtgtgcatcttctatctcgtgctccgagccctcgacactgttgaggacgacactagcattcctgccgcggtgaaggtgccgatccttaaggaattccatcggcatatctacaaccgcgactggcattattcatgtggaacaaaagactacaaattactgatggataagtttcgccttgtctccacggctttcttggagcttggtcaaggttatcaagaggcaattgaagaaatcactaggctaatgggagcaggaatggcaaaatttatctgcaaggaggttgaaactgttgatgactacaatgagtactgtcactatgtagcagggctagtggggtatgggctttccaggctctttcatgctggtgggacggaagatctggcttcagattcactttcaaattcaatgggcttgtttctgcagaaaatcaatataattagggattatttggaggacataaacgagataccaaagtcacgtatgttctggcctcgagaaatatggagtaaatatgtcaataaactcgaggatttgaaatacgaggaaaattcagaaaaggcagttcagtgtttgaatgatatggtgactaacgctctgtctcatgctgaagactgcctccaatacatgtcagcattgaaggatcatgccattttccgtttttgtgcaatacctcagataatggcaattgggacatgtgctatttgctacaataatgtgaatgtctttagaggagttgttaagatgaggcgtgggctcactgcacgagtaattgatgagacaaacacaatgtcagatgtctatactgctttctatgagttctcttcgctgatagaatcgaagattgataataatgatccaaatgcttccctaacgcggaaacgtgttgatgcgataaagagaacctgcaagtcatcttgctcactaaagagaaggggatacgatttggagaagtcaaagtacaactccatgctgataatggttgtacttctgttggtggctattgttttgggcatgatatatgccaagtga</cdnaseq>

Protein Sequence

<aaseq>MGVLSRPEEVLPLVKLRVAAGRIKRQIPPEEHWAFAYTMLQRVS RSFALVIQQLGPDLRNAVCIFYLVLRALDTVEDDTSIPAAVKVPILKEFHRHIYNRDW HYSCGTKDYKLLMDKFRLVSTAFLELGQGYQEAIEEITRLMGAGMAKFICKEVETVDD YNEYCHYVAGLVGYGLSRLFHAGGTEDLASDSLSNSMGLFLQKINIIRDYLEDINEIP KSRMFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALSHAEDCLQYMSALKDH AIFRFCAIPQIMAIGTCAICYNNVNVFRGVVKMRRGLTARVIDETNTMSDVYTAFYEF SSLIESKIDNNDPNASLTRKRVDAIKRTCKSSCSLKRRGYDLEKSKYNSMLIMVVLLL VAIVLGMIYAK</aaseq>

Gene Sequence

<dnaseqindica>293..475#600..642#837..926#1031..1106#1783..1852#2836..2979#3066..3170#3608..3754#5106..5181#5838..5926#6290..6381#6463..6502#6587..6643#cgaacacgcggagagagagagagagagagagaggaggaggaggagacgacgcggcgatcggcgagaccggaatccggcggcgacgccacccatctcccccgccgccgttggccgcggctagaagtagtggggggggggggggggctcgccggcgcgcgggcatcggcatcggcgtgagtagatcgtatcgtgcgagtggtggatcggaggagggtgatcgcgatttgtgaggaggggggggggggggggttgggatttggatttggatcgtggggatcagggggaggaggagatgggggtgctgtcgaggccggaggaggtgttgccgctggtgaagctgcgggtggcggcggggcggatcaagcggcagatcccgccggaggagcactgggccttcgcctacaccatgctgcagagggtctcccggagcttcgcgctcgtcatccagcagctcggccccgacctccgcaatgccgtcagtatccaccacctgttcctcctcctccccctcctcccatctgctgttcccgaattctcatgtgtttttacggtctcccgtgctcgaggagattctgatggccgttgtgctgattccgcaggtgtgcatcttctatctcgtgctccgagccctcgacactgttggtcagcaatttctctgaactactttgtacttttcaattgctttttgactttaccacgatttggtgatttggtgaatttttcttttcaaacaaagtggtttgtggcgccttttgaattattgaattacccatggtttttgtgttttcctttatcgacttacatactatgtttttttttttcatgggtgcgtgcagaggacgacactagcattcctgccgcggtgaaggtgccgatccttaaggaattccatcggcatatctacaaccgcgactggcattattcatgtacggtatcgctccactaaatatgctgttctcaggctgagcaggatggcggcttttttgtgttttgttaatcggagtttgattggtttgatgtgaccttgcaggtggaacaaaagactacaaattactgatggataagtttcgccttgtctccacggctttcttggagcttggtcaagggtaaattcagttccgagtcttctgaatgttttccttgtctgacttttcttggttcctagtacttcgcgacttgacatctttgaggcttctcatatattggcgttttctcaaattctttggacgcatgccatttctcaaattgtatattggcgtagtctcaaattctttggacgcgtcagtccagatattcatatccatgaaactacttcaagacttttctacataatgtggcgttcacttggtagtagtagctagctgagaaaccatcctgcatggtcagactcaaatggtgaaataaaaagctgatcatgatatttacacagtaagatgatttgtacgatgataattgctatgaattagcaaacaagcatcctacagaaaaacaggggactacacaaacttgaacggcagttatattcgtgaaccctatgaaccgtgttcttttgattgtttttgttagaacttcttcaatcctgttaatgttaagtattcttcacactcgattatatttggtcatatttatattatttcgacgaggagcagaccaaattttgttggaataacggagagcatgtgttcagccgtttctgaatgtaaaattgcattttactttggttgcccatatccccggatacttgcatcactcaatattctgatatactcttttctttcttagttatcaagaggcaattgaagaaatcactaggctaatgggagcaggaatggcaaaatttatctgcaaggaggtatgttgttaatatagccatcaaaacatctaagcaaacataattttgaaataaatgttttggtgcaatgttcttaacataaggagatcacaaggtcattttattcaaaaaccagtatttaattttagtgtgaggcgatgaccttgtactctttttttttttctggtttccatatcagcagtagatggtaaggcctatgtctcatcacttattagaaatgtctgccctgtatatggtactatccgtgcatattcttttctggctcaaaaaatagggtacagtccatggtgtgtttcggtaacttcatgcttggtaggagtgttactgtgaattttgaccaaagagaatgacaaaagcctgtgtgcttgtgtccatatacttttccacgctattcctaagtcctaaggtatctagtgaatagccagtggccactatatatcgtgcttaaaagaacaaatgtttttactggtattcaagtgatgaccaaaggctataacagatggtcatatgcttcatgcaaccttgacatgcttttatgccttcttttcagttccatgtccagtttttggctgtcctatcagtaagtggttgtacttttggtttcctccatatgaaagatgttatctaccttgtggccatttgtagtctcacagaatatactatgaaatgcctgatctgaaacaataacaaagacacaatattctcttcaaaattgtgataaatcttttcgatggtatctagtgtccaccctcaattggctacattattacgtggatctgaactttattagattccctcatatttccatgggatatgcttagacatgttttagttgcatctagtaaaattagggagtaaacgattaattgcaatatagtttgtcattagttttcaagaacaaaaaggagtttgtagcatatgtattgatgaaatgctgatttaatactgtttttaactaacatgaaacaactttgtttacataggttgaaactgttgatgactacaatgagtactgtcactatgtagcagggctagtggggtatgggctttccaggctctttcatgctggtgggacggaagatctggcttcagattcactttcaaattcaatgggcttgtttctgcaggttttttgttgattttgttgaatcagttatgtgcacttacagtttctaattgttgttagtaaccaatatctggacttacactgcagaaaatcaatataattagggattatttggaggacataaacgagataccaaagtcacgtatgttctggcctcgagaaatatggagtaaatatgtcaataaactcgaggtatactgtccatgtatcttcttttttcttactgagtactacctccgtcccaaaatacttgtcgttctaggttatttagcatgtactaaggtttgaagacaaagactataataccccttaattaataatgcatagttggatgtggaatgatggttgggggtataatggggagaaatttgaattggaagtggttgatatgacaagtagtattttaaagtgacaactattttgggacaagtattgtgggacggaggaagtagctttaaatttattcgaaatgattaaattgtcaccacaattgacaagagatgccatttgaagtgttaaatccaactgtcaataaccaaataatataaattcatttattatgctggaaagtccactacagttttatctattttctgtgtgtaataatacacatttttttataaaatcaggatttgaaatacgaggaaaattcagaaaaggcagttcagtgtttgaatgatatggtgactaacgctctgtctcatgctgaagactgcctccaatacatgtcagcattgaaggatcatgccattttccgtttttgtgcaatacctcaggtatatgttaatcttttatagtaccaaatttttgaaccaatgcaaattgtgccagtctgtgtcaaatattaacagtttatgatattctcttgtgcttgcttgcagtatataatgataacttttatattggccatgaagtttagttaagctattgctagtgtacacctattgctagtgtacacgtctaggaaattttactcttttttttaaaatatctgtatgtaatgctgattgtaatgcctagggtccaggtatggatctaagcccaactcatctacttgaaccacacatctgagtgacggttaaccgggaatttattctaccagactactacttataagctggtgcacatggagccagctagccgaggtggtactgagcaagcgttttcaggctatgctagctagcgtactcttctgctatcgatgaaaccgaaagaaaataccagtgctctttcatatagatcgagatgcagtaagacaggctttctcgaagtagggttgtaccattagaaatagttaggctaggtccttgacccctaccttttctgagattcatggaatcatcacattaattacgcacgaatcagaatggggcctatctatattccaagtagtacccctcgtccagtgaagtcatgaggctagcccccctgaatgaagtagcggagccctctgcccacaacgctttagctaatacacagaaatgcatacctttatttttctgtaattcaatgactgcatgcattgctcggtgaatgtgaagaactaggctgttgtcgcggcaataatgaggcaatctaaaaaactagctacaggcttgcttgctgctgctgctgctcctgctcctgctcctgcatttgctgtcgtgtttactagctagcgctattgctgctgtgctcacatgtggcccaaggccagatggctgttctgcttgctgctcacttgcgcctacgctaactagcttgctcattgctgcctgcttacttgctcttcttctctatcttttccccttcatctctatttttttcctaattattctggggcgtcacagactcacagtaatttactgctatagcaaatctttgtaccatatctgtggtaaagaggagccagctatttgaattggtttgtttattagttcatgtttgatcactgttgacatgctaaatcttgggccaatgatagttgatatttgttggcagttgggtagcattcctcgttggttgaagctgttaattgacctaacattttgtgtttgagtattatacacttctattcttgtaatatgtttggtatgtattattttggaacaaactttaggatactaatacatcattccatcttttcagataatggcaattgggacatgtgctatttgctacaataatgtgaatgtctttagaggagttgttaagatgaggcgtggtaagattacataagacatactaagtaaattcaaattgcagtaacctctctttactttgaggagaatagttattttatctccatgaccaccttgtcagagtttgcttaatggaattcaatatggataggctatccggttctcttcttttgtatggttaatttaagagtaattgtatttatttactcagttgtcagaaattgatcaatgtgcaacaataatcctattggttacacaatggagtgctcctgtgttcattgtcacaagttggcatcattgtaacttgtgtcagttttgttgattagtgtatcataagatttcaccacttcattgctggcatttctttgtcccttttggtttagacaaagaatggtgatttgttgagtaagatgactagatgagtatctttagaattattgtatgctttgttttttgggcacatggctccatatctcagtagaacagctataatttagttagcagaaggtgcaactataatttatatatatttatcactgaatttgcatagtagtaataatttccttaagcaactttattttgttttgtcacctttatctattataaactaagtacatctgctccagtctctagttacctttatgttctctcacctcaggaaattaacatgttctctcagggctcactgcacgagtaattgatgagacaaacacaatgtcagatgtctatactgctttctatgagttctcttcgctgatagaatcgaaggtaaggaccatgatctttgctaccatgaatgtagggtggctgtcgctcatttcttccatatagataataagacactcaaatatttcattttttacaatagattgctatccatcaattgtattgcacaaaaatcttcactcagtataattattttttgttaatatgtaaacatttcttttgaacttgttctttgagccacttttgcattaaatgttgtgttgatttaaggatcatgaaattattttagtcttcagcagaatgttctaaacagcaaatataggatgtgcactgttatttctggccttcaaaggctaccttagttgtcctgctcaagagtgtatgatgttttacccacatgtccagattgataataatgatccaaatgcttccctaacgcggaaacgtgttgatgcgataaagagaacctgcaagtcatcttgctcactaaagagaaggtttgttggttgattctgatttagtgttccatttatttctgttggcatttctcatccctaccgatcatcttaattatgcaggggatacgatttggagaagtcaaagtacaactccatgctggtgagaataatatataaaccttaaatccttttagtgattctgtttctatttatctttctcaaactgtttctgtgacttgctcagataatggttgtacttctgttggtggctattgttttgggcatgatatatgccaagtgattcgtcctaggtggtccattgccctcaactagacaatctatgcgcatcaggtatgtcaaatggtttcaacaattttacctgttctatttcgttttaaaatttgaaacagggaagggcctgctgaatttgatcatgaagtgaatttgatatccagatttcttatcagcgccaactccaaagcacatgcagcaattataagtactgactgactgcaagaatagactgtacttctatgaagttggatctcttcacctatctgttcaccctaaaccttttcatggtttataagaatgcgggttgtttcttgcaaaattttgggtagaatggtgcaaaaaagaatttgttcgataatgaagatagctgtggttttgttagcttgtgttatattgatgtaatttaagatcatgcgagtgtttattttcccggcgacattcttttgtttattcattatatgcagtatccatttatcttggctctca</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0805100, RefSeq:Os03g0805100