Difference between revisions of "Os05g0129300"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice gene Os05g0129300 was reported as '''''LIP19''''' in 2005<ref name="ref1"/> and 1993<ref name="ref2"/>, '''''OsbZIP38''''' in 2008<ref name="ref3"/>, respectively.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*The rice low-temperature-induced ''lip19'' gene encodes a 148-amino-acid basic region/leucine zipper (bZIP) protein, termed ''LIP19''. It '''lacks the usual ability of bZIP proteins''' to '''homodimerize''' and to '''bind DNA''', as does the Fos protein in mammals. Once the temperature returns to 25°C, the instability of ''LIP19'' may '''switch off''' this '''low-temperature signaling'''<ref name="ref1"/>.
 +
 
 +
*The protein–protein interaction in homo- and hetero-combinations between ''LIP19'' and ''OsOBF1'' was confirmed in vitro and in planta. ''LIP19'' and ''OsOBF1'' most likely '''interact with each other''' more strongly than ''OsOBF1'' '''interacts with itself''', and the resulting heterodimer '''binds to the C/G hybrid sequence''' but not to the hexamer sequence<ref name="ref1"/>. 
 +
 
 +
*''Lip19'' is '''a transcriptional factor''' that is '''positively controlled by low temperature'''<ref name="ref2"/>. 
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0005634 GO:0005634],[http://amigo.geneontology.org/amigo/term/GO:0043565 GO:0043565], [http://amigo.geneontology.org/amigo/term/GO:0046983 GO:0046983]
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*The expression patterns of ''lip19'' and ''OsOBF1'' in '''response to low temperatures''' were totally '''opposite'''. '''In leaf blades''' of rice plants exposed to 5°C for 24 h, ''lip19'' transcripts were '''abundantly''' and '''primarily''' detected in '''mesophyll cells surrounding vascular bundles'''<ref name="ref1"/>. 
 +
 
 +
*Expression of lipI9 is '''positively regulated by low temperature''', but '''not affected by high temperature'''. Expression of rice lipl9 was markedly induced by low temperature not only in '''scutellum-derived suspension cells''', but also in '''plantlets'''<ref name="ref2"/>. It should be noted that ''OsbZIP38'' (up-regulated under cold treatment) corresponds to the earlier identified rice low-temperature-induced LIP19 gene<ref name="ref3"/>.
 +
 
 +
===Subcellular localization===
 +
Both LIP19 and OsOBF1 '''localized in the nuclei'''<ref name="ref1"/>.  
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
*Sequencing and primer extension analyses showed that ''lip19'' has a long 5' non-coding sequence followed by a single open reading frame specifying a protein of 148 amino acids. The deduced amino acid sequence of the protein, Lip19, shows at its amino-terminus a conserved basic region followed by a "leucine-zipper" domain. The reported '''sequence most similar to ''Lip19''''' is '''maize ''OCSBF-1''''', which is a bZip-type DNA binding protein<ref name="ref2"/>. 
 +
 
 +
*Searches of the current database showed that ''lipi9'' shared '''53.5% homology''' at the nucleotide sequence level with the maize OCSBF-1 gene. The nucleotide sequences of the coding regions for the lipl9 and OCSBF-1 gene products showed '''64.2% homology'''<ref name="ref2"/>. 
  
You can also add sub-section(s) at will.
+
===Knowledge Extension===
 +
*bZIP transcription factors have been characterized in different plant species and linked to various developmental and physiological processes. An extensive study of 89 rice bZIP genes has been performed in terms of structure, phylogeny, sequence, and expression analyses<ref name="ref3"/>.
 +
 +
*Structural differences between different OsbZIP members have been studied and an attempt made to link them to their functional roles in rice in a meaningful manner<ref name="ref3"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Graduate School of Life Sciences, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi, 980-8577 Japan
 +
*Botanisches Institut, Goethe-Universität, Postfach 11 19 32, D-60054, Frankfurt am Main, Germany
 +
*Winter Stress Laboratory, National Agricultural Research Center for Hokkaido Region, Hitsujigaoka 1, Toyohira-ku, Sapporo, 062-8555 Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Shimizu H, Sato K, Berberich T, et al. LIP19, a basic region leucine zipper protein, is a Fos-like molecular switch in the cold signaling of rice plants[J]. Plant and cell physiology, 2005, 46(10): 1623-1634.
 +
</ref>
 +
* <ref name="ref2">
 +
Aguan K, Sugawara K, Suzuki N, et al. Low-temperature-dependent expression of a rice gene encoding a protein with a leucine-zipper motif[J]. Molecular and General Genetics MGG, 1993, 240(1): 1-8.
 +
</ref>
 +
* <ref name="ref3">
 +
Nijhawan A, Jain M, Tyagi A K, et al. Genomic survey and gene expression analysis of the basic leucine zipper transcription factor family in rice[J]. Plant Physiology, 2008, 146(2): 333-350.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 09:33, 12 March 2015

The rice gene Os05g0129300 was reported as LIP19 in 2005[1] and 1993[2], OsbZIP38 in 2008[3], respectively.

Annotated Information

Function

  • The rice low-temperature-induced lip19 gene encodes a 148-amino-acid basic region/leucine zipper (bZIP) protein, termed LIP19. It lacks the usual ability of bZIP proteins to homodimerize and to bind DNA, as does the Fos protein in mammals. Once the temperature returns to 25°C, the instability of LIP19 may switch off this low-temperature signaling[1].
  • The protein–protein interaction in homo- and hetero-combinations between LIP19 and OsOBF1 was confirmed in vitro and in planta. LIP19 and OsOBF1 most likely interact with each other more strongly than OsOBF1 interacts with itself, and the resulting heterodimer binds to the C/G hybrid sequence but not to the hexamer sequence[1].
  • Lip19 is a transcriptional factor that is positively controlled by low temperature[2].


GO assignment(s): GO:0005634,GO:0043565, GO:0046983

Expression

  • The expression patterns of lip19 and OsOBF1 in response to low temperatures were totally opposite. In leaf blades of rice plants exposed to 5°C for 24 h, lip19 transcripts were abundantly and primarily detected in mesophyll cells surrounding vascular bundles[1].
  • Expression of lipI9 is positively regulated by low temperature, but not affected by high temperature. Expression of rice lipl9 was markedly induced by low temperature not only in scutellum-derived suspension cells, but also in plantlets[2]. It should be noted that OsbZIP38 (up-regulated under cold treatment) corresponds to the earlier identified rice low-temperature-induced LIP19 gene[3].

Subcellular localization

Both LIP19 and OsOBF1 localized in the nuclei[1].

Evolution

  • Sequencing and primer extension analyses showed that lip19 has a long 5' non-coding sequence followed by a single open reading frame specifying a protein of 148 amino acids. The deduced amino acid sequence of the protein, Lip19, shows at its amino-terminus a conserved basic region followed by a "leucine-zipper" domain. The reported sequence most similar to Lip19 is maize OCSBF-1, which is a bZip-type DNA binding protein[2].
  • Searches of the current database showed that lipi9 shared 53.5% homology at the nucleotide sequence level with the maize OCSBF-1 gene. The nucleotide sequences of the coding regions for the lipl9 and OCSBF-1 gene products showed 64.2% homology[2].

Knowledge Extension

  • bZIP transcription factors have been characterized in different plant species and linked to various developmental and physiological processes. An extensive study of 89 rice bZIP genes has been performed in terms of structure, phylogeny, sequence, and expression analyses[3].
  • Structural differences between different OsbZIP members have been studied and an attempt made to link them to their functional roles in rice in a meaningful manner[3].

Labs working on this gene

  • Graduate School of Life Sciences, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi, 980-8577 Japan
  • Botanisches Institut, Goethe-Universität, Postfach 11 19 32, D-60054, Frankfurt am Main, Germany
  • Winter Stress Laboratory, National Agricultural Research Center for Hokkaido Region, Hitsujigaoka 1, Toyohira-ku, Sapporo, 062-8555 Japan

References

  1. 1.0 1.1 1.2 1.3 1.4 Shimizu H, Sato K, Berberich T, et al. LIP19, a basic region leucine zipper protein, is a Fos-like molecular switch in the cold signaling of rice plants[J]. Plant and cell physiology, 2005, 46(10): 1623-1634.
  2. 2.0 2.1 2.2 2.3 2.4 Aguan K, Sugawara K, Suzuki N, et al. Low-temperature-dependent expression of a rice gene encoding a protein with a leucine-zipper motif[J]. Molecular and General Genetics MGG, 1993, 240(1): 1-8.
  3. 3.0 3.1 3.2 3.3 Nijhawan A, Jain M, Tyagi A K, et al. Genomic survey and gene expression analysis of the basic leucine zipper transcription factor family in rice[J]. Plant Physiology, 2008, 146(2): 333-350.

Structured Information

Gene Name

Os05g0129300

Description

Basic/leucine zipper protein

Version

NM_001061079.1 GI:115461888 GeneID:4337699

Length

1374 bp

Definition

Oryza sativa Japonica Group Os05g0129300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:1695754..1697127

Sequence Coding Region

1696307..1696753

Expression

GEO Profiles:Os05g0129300

Genome Context

<gbrowseImage1> name=NC_008398:1695754..1697127 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:1695754..1697127 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcgtcgccttcgcgccggagctccagcccggagagcaacaccagcggcggcggcggtggcgccgacgagcggaagaggaagaggatgctgtcgaacagggagtcggcgaggcgatccagggcgaggaagcagcagaggctggaggagctgatcgccgaggcggcgcgcctccaggccgagaacgcgcgcgtcgaggcgcagatcggggcctacgcgggggagctgagcaaggtcgacggcgagaacgcggtgctccgcgcccgccacggcgagctcgccgggcgcctccaggcgctcggcagcgtcctggagatcctccaggtggccggcgcgcccgtcgacatcccggagatccccgacgacccgctgctccgcccatggcagccgccgttcgcggcccagcccatcgtcgccaccgccatggccgacgccttccagttctga</cdnaseq>

Protein Sequence

<aaseq>MSSPSRRSSSPESNTSGGGGGADERKRKRMLSNRESARRSRARK QQRLEELIAEAARLQAENARVEAQIGAYAGELSKVDGENAVLRARHGELAGRLQALGS VLEILQVAGAPVDIPEIPDDPLLRPWQPPFAAQPIVATAMADAFQF</aaseq>

Gene Sequence

<dnaseqindica>554..1000#ttccccatccgtctaattgcgccccttatgcattagagcccccggagtcccctctgtttcgcagataagtcctttggttcccatctttttattacattcaggtcctcctagtttcttttcctttcgagtctactccttgcattcttgcgaggaagcccctcgggttggtcgaattttagtttccactccctctcctcggggagtcgttgctgttcttgttcttggtcgaggttgaggttggtggcgtagatccgatctgaggaatgtttacctatcctttcctctaacgttcgccgtactccgatgaagttgaacgtgctccgccgccgccgttcccactccttctccgtcgccttcctctactggttctacgtcttctcatgaactcatcgccttcctcccaagaacaccatctccagcctctaattgattatatcttgatttctttttcatcctcctactagtttctttcttgtgttctttggaatttttttgatctcttgaagagatccggttcttggattaagttttggacaagaaccgtactgtgaccatgtcgtcgccttcgcgccggagctccagcccggagagcaacaccagcggcggcggcggtggcgccgacgagcggaagaggaagaggatgctgtcgaacagggagtcggcgaggcgatccagggcgaggaagcagcagaggctggaggagctgatcgccgaggcggcgcgcctccaggccgagaacgcgcgcgtcgaggcgcagatcggggcctacgcgggggagctgagcaaggtcgacggcgagaacgcggtgctccgcgcccgccacggcgagctcgccgggcgcctccaggcgctcggcagcgtcctggagatcctccaggtggccggcgcgcccgtcgacatcccggagatccccgacgacccgctgctccgcccatggcagccgccgttcgcggcccagcccatcgtcgccaccgccatggccgacgccttccagttctgagccaccatggagagctcgcacgccatggccattggcatcaatggcatggttgcagctgcattacaactagtagtactagcctctgtggttgtgtctgatgatgcttattatgtttaattatggtttgcttcatgttgttttcattaatctagaccattaataagcaatgtgtgttgtaatcttgtctagtcttatgtgagatgtgttcatctccagtgctccttgctaataagggtggaagagaacaatccgatttgatgtaattcttggagagcacatgtgtgctggtttgtgatgtgatgaactgatgattgtaatattttgacattgaacctatgctataatgtttgcagcaatgaatctatccttgtgtc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0129300, RefSeq:Os05g0129300