Difference between revisions of "Os06g0603600"
(Wang C, Wei Q, Zhang K, et al. Down-Regulation of OsSPX1 Causes High Sensitivity to Cold and Oxidative Stresses in Rice Seedlings[J]. PloS one, 2013, 8(12): e81849.) |
|||
| Line 1: | Line 1: | ||
| − | + | '''''OsSPX1''''' acts via a '''negative feedback loop''' to '''optimize growth under phosphate-limited conditions'''<ref name="ref1"/><ref name="ref2"/>. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | *''OsSPX1'' '''suppresses either Pi uptake''' or the '''transfer of Pi from the roots to the leaves'''. Rice PHO2 has a similar function to that of its ''Arabidopsis'' ortholog. ''OsSPX1'' plays a role in '''suppression of the Pi-starvation signal''', the suppression of OsSPX1 may have promoted Pi uptake by stimulating Pi transporters<ref name="ref1"/>. | |
| + | |||
| + | *OsSPX1 is a '''negative regulator of OsPHR2''' and is involved in the feedback of Pi-signaling network in roots that is defined by OsPHR2 and OsPHO2<ref name="ref2"/>. OsSPX1 regulates OsSPX2, 3 and 5 at the transcription level and is positively involved in the responses of the genes to Pi-starvation<ref name="ref3"/>. | ||
| + | |||
| + | *OsSPX1 may be a '''regulator involved in the transcriptions of OsSPX2''', '''3''' and '''5'''<ref name="ref3"/>. OsSPX1 may play an '''important role in linking cold stress''' and '''Pi starvation signal transduction pathways'''<ref name="ref4"/>. OsSPX1 may be '''involved in cross-talks between oxidative stress''', '''cold stress''' and '''phosphate homeostasis''' in '''rice seedling leaves'''. Down-regulation of OsSPX1 causes high sensitivity to cold and oxidative stresses in rice seedlings<ref name="ref5"/>. | ||
| + | |||
| + | ===Mutation=== | ||
| + | *OsSPX1-Oe and OsSPX1-Ri<ref name="ref1"/>: | ||
| + | **OsSPX1-Oe:OsSPX1 overexpression construct | ||
| + | **OsSPX1-Ri:OsSPX1 RNA interference construct | ||
| + | **Expression of OsPT2 (phosphate transporter 2) and OsPT8 was '''significantly induced''' in OsSPX1-RNAi (OsSPX1-Ri) plants, suggesting that '''over-accumulation of Pi''' in OsSPX1-Ri plants results from an '''increase in Pi transport'''. | ||
| + | **'''Under Pi-sufficient conditions''', the OsSPX1-Oe plants '''accumulated a substantial amount of the transcript''', whereas the level of transcript was '''very low''' in wild-type (WT) and RNAi roots. Elimination of Pi from the nutrient solution for 5 days '''increased''' the expression of OsSPX1 mRNA in the roots of WT plants nearly 10-fold. Expression of OsSPX1 was '''suppressed by''' introduction of the RNAi construct '''under both Pi-sufficient and -deficient conditions'''. | ||
| + | |||
| + | *Transgenic tobacco plants with constitutive expression of OsSPX1 were '''more tolerant to cold stress''' than were wild-type plants, and showed '''better seedling survival''' and '''reduced cellular electrolyte leakage'''. In addition, there was decreased total leaf Pi content and accumulation of free proline and sucrose in transgenic tobacco plants during cold stress<ref name="ref4"/>. | ||
| + | |||
| + | *Transgenic lines and wild-type<ref name="ref5"/>: | ||
| + | **Down-regulation of OsSPX1 caused '''high sensitivity to cold and oxidative stresses''' in rice seedlings. Compared to wild-type and OsSPX1-sense transgenic lines, '''more hydrogen peroxide accumulated''' in '''seedling leaves''' of OsSPX1-antisense transgenic lines for controls, cold and methyl viologen (MV) treatments. Glutathione as a ROS scavenger could protect the antisense transgenic lines from cold and MV stress. | ||
===Expression=== | ===Expression=== | ||
| − | + | *OsSPX1, is '''specifically induced by Pi starvation''' in '''roots'''. '''Suppression''' of OsSPX1 by RNA interference resulted in '''severe signs of toxicity''' caused by the '''over-accumulation of Pi''', similar to that found in OsPHR2 overexpressors and pho2. '''Quantitative RT-PCR''' showed that expression of OsSPX1 was strongly induced in OsPHR2 overexpression and pho2 mutant plants, indicating that OsSPX1 '''occurs downstream of OsPHR2 and PHO2'''<ref name="ref1"/>. | |
| + | |||
| + | *Overexpression of OsSPX1 suppressed the induction of expression by Pi starvation of all 10 phosphate starvation-induced genes tested: IPS1, IPS2, OsPAP10, OsSQD2, miR399d and miR399j, OsPT2, OsPT3, OsPT6 and OsPT8<ref name="ref1"/>. The quantitative real-time PCR results showed that OsSPX1 expression is increased in the pho2 mutant, indicating negative feedback regulation of OsPHO2 on OsSPX1<ref name="ref2"/>. | ||
| + | |||
| + | *'''Under Pi-sufficient conditions''', both overexpression and repression of OsSPX1 downregulated OsSPX2 '''in shoots'''. In roots OsSPX3 and OsSPX5 were '''downregulated by overexpression of OsSPX1''', Under Pi-starvation, overexpression of OsSPX1 '''aggravated the responses of OsSPX3 and OsSPX5 to Pi-starvation''', and repression of OsSPX1 reduced the responses of OsSPX2, 3, 5 and OsIPS1 to Pi-starvation in shoots. In roots, repression of OsSPX1 downregulated OsSPX2 and OsSPX3, and reduced the responses of OsSPX5 and OsIPS1 to Pistarvation<ref name="ref3"/>. | ||
| + | |||
| + | *Over-expression of OsSPX1 '''enhanced cold tolerance''' and '''affected gene expression of Pi starvation-related genes''' during cold stress in ''Arabidopsis''<ref name="ref4"/>. Rice whole genome GeneChip analysis showed that some oxidative-stress marker genes and Pi-signaling pathway related genes were '''significantly down-regulated by''' the antisense of OsSPX1<ref name="ref5"/>. | ||
| + | |||
| + | ===Subcellular localization=== | ||
| + | OsSPX1, is a '''nucleus localization protein'''<ref name="ref3"/>. | ||
===Evolution=== | ===Evolution=== | ||
| − | + | [[File: OsSPX1 phylogenic1.jpg|right|thumb|250px|'''Figure 1.''' ''Phylogenetic tree of OsSPX1–6 and homologous proteins from other eukaryotes.(from reference <ref name="ref3"/>).'']] | |
| + | Phylogenetic analysis for the SPX domain proteins of rice (Oryza sativa L.) and ''Arabidopsis'', IDS4 protein in barley (Hordeum vulgare) and tomato (Lycopersicon esculentum), ADL143Wp in cotton (Ashbya gossypii) and PHO81 in yeast (Saccharomyces cerevisiae) indicates that OsSPX members can be grouped into three subgroups. OsSPX4 is in the first subgroup with AtSPX4, ScPHO81, AgADL | ||
| + | and HvIDS-4, the second subgroup including OsSPX3,OsSPX5 and OsSPX6 closed to AtSPX3, and the third subgroup contains OsSPX1 and OsSPX2 with LeIDS4-like, AtSPX1 and AtSPX2. The results indicate the conservation of the SPX domain genes between monocot and dicot species (Figure 1)<ref name="ref3"/>. | ||
| + | |||
| + | ===Knowledge Extension=== | ||
| + | [[File: OsSPX1 regulatory network.jpg|right|thumb|250px|'''Figure 2.''' ''A suggested regulatory network of OsSPX1 and OsSPX3 on Pi-signaling and transcriptions of OsSPX2, 3 and 5.(from reference <ref name="ref3"/>).'']] | ||
| + | Six OsSPX genes with exclusive SPX domain were identified in rice. Five of the genes are responsive to Pistarvation in shoot and/or in root, indicating that the subset of SPX genes is involved in the Pi-signaling network in a complex regulatory system (Figure 2). OsSPX1, as a nucleus localization protein, regulates transcriptions of OsSPX2, 3 and 5. OsSPX3 negatively regulates OsIPS1 and may be involved | ||
| + | in the systemic regulatory network of OsIPS1, OsmiR399 andOsPHO2. OsSPX3 also functions on plant growth<ref name="ref3"/>. | ||
| − | + | ==Labs working on this gene== | |
| + | *State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058, China | ||
| + | *National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China, and | ||
| + | *State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beichen West Road 1, Chaoyang District, Beijing 100101, China | ||
| + | *State Key Laboratory for Agricultural Biotechnology, College of Biological Sciences, China Agricultural University, Beijing 100094, China | ||
| + | *State Key Laboratory of Plant Physiology and Biochemistry, College of Biological Sciences, China Agricultural University, Beijing 100094, China | ||
| + | *Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences and National Centre for Plant Gene Research, Beijing 100080, China | ||
| + | *Biology Department, San Diego State University, San Diego, California, United States of America | ||
| − | |||
| − | |||
==References== | ==References== | ||
| − | + | <references> | |
| + | * <ref name="ref1"> | ||
| + | Wang C, Ying S, Huang H, et al. Involvement of OsSPX1 in phosphate homeostasis in rice[J]. The Plant Journal, 2009, 57(5): 895-904. | ||
| + | </ref> | ||
| + | * <ref name="ref2"> | ||
| + | Liu F, Wang Z, Ren H, et al. OsSPX1 suppresses the function of OsPHR2 in the regulation of expression of OsPT2 and phosphate homeostasis in shoots of rice[J]. The Plant Journal, 2010, 62(3): 508-517. | ||
| + | </ref> | ||
| + | * <ref name="ref3"> | ||
| + | Wang Z, Hu H, Huang H, et al. Regulation of OsSPX1 and OsSPX3 on Expression of OsSPX domain Genes and Pi‐starvation Signaling in Rice[J]. Journal of Integrative Plant Biology, 2009, 51(7): 663-674. | ||
| + | </ref> | ||
| + | * <ref name="ref4"> | ||
| + | Zhao L, Liu F, Xu W, et al. Increased expression of OsSPX1 enhances cold/subfreezing tolerance in tobacco and Arabidopsis thaliana[J]. Plant biotechnology journal, 2009, 7(6): 550-561. | ||
| + | </ref> | ||
| + | * <ref name="ref5"> | ||
| + | Wang C, Wei Q, Zhang K, et al. Down-Regulation of OsSPX1 Causes High Sensitivity to Cold and Oxidative Stresses in Rice Seedlings[J]. PloS one, 2013, 8(12): e81849. | ||
| + | </ref> | ||
| + | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 08:15, 23 March 2015
OsSPX1 acts via a negative feedback loop to optimize growth under phosphate-limited conditions[1][2].
Contents
Annotated Information
Function
- OsSPX1 suppresses either Pi uptake or the transfer of Pi from the roots to the leaves. Rice PHO2 has a similar function to that of its Arabidopsis ortholog. OsSPX1 plays a role in suppression of the Pi-starvation signal, the suppression of OsSPX1 may have promoted Pi uptake by stimulating Pi transporters[1].
- OsSPX1 is a negative regulator of OsPHR2 and is involved in the feedback of Pi-signaling network in roots that is defined by OsPHR2 and OsPHO2[2]. OsSPX1 regulates OsSPX2, 3 and 5 at the transcription level and is positively involved in the responses of the genes to Pi-starvation[3].
- OsSPX1 may be a regulator involved in the transcriptions of OsSPX2, 3 and 5[3]. OsSPX1 may play an important role in linking cold stress and Pi starvation signal transduction pathways[4]. OsSPX1 may be involved in cross-talks between oxidative stress, cold stress and phosphate homeostasis in rice seedling leaves. Down-regulation of OsSPX1 causes high sensitivity to cold and oxidative stresses in rice seedlings[5].
Mutation
- OsSPX1-Oe and OsSPX1-Ri[1]:
- OsSPX1-Oe:OsSPX1 overexpression construct
- OsSPX1-Ri:OsSPX1 RNA interference construct
- Expression of OsPT2 (phosphate transporter 2) and OsPT8 was significantly induced in OsSPX1-RNAi (OsSPX1-Ri) plants, suggesting that over-accumulation of Pi in OsSPX1-Ri plants results from an increase in Pi transport.
- Under Pi-sufficient conditions, the OsSPX1-Oe plants accumulated a substantial amount of the transcript, whereas the level of transcript was very low in wild-type (WT) and RNAi roots. Elimination of Pi from the nutrient solution for 5 days increased the expression of OsSPX1 mRNA in the roots of WT plants nearly 10-fold. Expression of OsSPX1 was suppressed by introduction of the RNAi construct under both Pi-sufficient and -deficient conditions.
- Transgenic tobacco plants with constitutive expression of OsSPX1 were more tolerant to cold stress than were wild-type plants, and showed better seedling survival and reduced cellular electrolyte leakage. In addition, there was decreased total leaf Pi content and accumulation of free proline and sucrose in transgenic tobacco plants during cold stress[4].
- Transgenic lines and wild-type[5]:
- Down-regulation of OsSPX1 caused high sensitivity to cold and oxidative stresses in rice seedlings. Compared to wild-type and OsSPX1-sense transgenic lines, more hydrogen peroxide accumulated in seedling leaves of OsSPX1-antisense transgenic lines for controls, cold and methyl viologen (MV) treatments. Glutathione as a ROS scavenger could protect the antisense transgenic lines from cold and MV stress.
Expression
- OsSPX1, is specifically induced by Pi starvation in roots. Suppression of OsSPX1 by RNA interference resulted in severe signs of toxicity caused by the over-accumulation of Pi, similar to that found in OsPHR2 overexpressors and pho2. Quantitative RT-PCR showed that expression of OsSPX1 was strongly induced in OsPHR2 overexpression and pho2 mutant plants, indicating that OsSPX1 occurs downstream of OsPHR2 and PHO2[1].
- Overexpression of OsSPX1 suppressed the induction of expression by Pi starvation of all 10 phosphate starvation-induced genes tested: IPS1, IPS2, OsPAP10, OsSQD2, miR399d and miR399j, OsPT2, OsPT3, OsPT6 and OsPT8[1]. The quantitative real-time PCR results showed that OsSPX1 expression is increased in the pho2 mutant, indicating negative feedback regulation of OsPHO2 on OsSPX1[2].
- Under Pi-sufficient conditions, both overexpression and repression of OsSPX1 downregulated OsSPX2 in shoots. In roots OsSPX3 and OsSPX5 were downregulated by overexpression of OsSPX1, Under Pi-starvation, overexpression of OsSPX1 aggravated the responses of OsSPX3 and OsSPX5 to Pi-starvation, and repression of OsSPX1 reduced the responses of OsSPX2, 3, 5 and OsIPS1 to Pi-starvation in shoots. In roots, repression of OsSPX1 downregulated OsSPX2 and OsSPX3, and reduced the responses of OsSPX5 and OsIPS1 to Pistarvation[3].
- Over-expression of OsSPX1 enhanced cold tolerance and affected gene expression of Pi starvation-related genes during cold stress in Arabidopsis[4]. Rice whole genome GeneChip analysis showed that some oxidative-stress marker genes and Pi-signaling pathway related genes were significantly down-regulated by the antisense of OsSPX1[5].
Subcellular localization
OsSPX1, is a nucleus localization protein[3].
Evolution
Phylogenetic analysis for the SPX domain proteins of rice (Oryza sativa L.) and Arabidopsis, IDS4 protein in barley (Hordeum vulgare) and tomato (Lycopersicon esculentum), ADL143Wp in cotton (Ashbya gossypii) and PHO81 in yeast (Saccharomyces cerevisiae) indicates that OsSPX members can be grouped into three subgroups. OsSPX4 is in the first subgroup with AtSPX4, ScPHO81, AgADL and HvIDS-4, the second subgroup including OsSPX3,OsSPX5 and OsSPX6 closed to AtSPX3, and the third subgroup contains OsSPX1 and OsSPX2 with LeIDS4-like, AtSPX1 and AtSPX2. The results indicate the conservation of the SPX domain genes between monocot and dicot species (Figure 1)[3].
Knowledge Extension
Six OsSPX genes with exclusive SPX domain were identified in rice. Five of the genes are responsive to Pistarvation in shoot and/or in root, indicating that the subset of SPX genes is involved in the Pi-signaling network in a complex regulatory system (Figure 2). OsSPX1, as a nucleus localization protein, regulates transcriptions of OsSPX2, 3 and 5. OsSPX3 negatively regulates OsIPS1 and may be involved in the systemic regulatory network of OsIPS1, OsmiR399 andOsPHO2. OsSPX3 also functions on plant growth[3].
Labs working on this gene
- State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058, China
- National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China, and
- State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beichen West Road 1, Chaoyang District, Beijing 100101, China
- State Key Laboratory for Agricultural Biotechnology, College of Biological Sciences, China Agricultural University, Beijing 100094, China
- State Key Laboratory of Plant Physiology and Biochemistry, College of Biological Sciences, China Agricultural University, Beijing 100094, China
- Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences and National Centre for Plant Gene Research, Beijing 100080, China
- Biology Department, San Diego State University, San Diego, California, United States of America
References
- ↑ 1.0 1.1 1.2 1.3 1.4 Wang C, Ying S, Huang H, et al. Involvement of OsSPX1 in phosphate homeostasis in rice[J]. The Plant Journal, 2009, 57(5): 895-904.
- ↑ 2.0 2.1 2.2 Liu F, Wang Z, Ren H, et al. OsSPX1 suppresses the function of OsPHR2 in the regulation of expression of OsPT2 and phosphate homeostasis in shoots of rice[J]. The Plant Journal, 2010, 62(3): 508-517.
- ↑ 3.0 3.1 3.2 3.3 3.4 3.5 3.6 3.7 Wang Z, Hu H, Huang H, et al. Regulation of OsSPX1 and OsSPX3 on Expression of OsSPX domain Genes and Pi‐starvation Signaling in Rice[J]. Journal of Integrative Plant Biology, 2009, 51(7): 663-674.
- ↑ 4.0 4.1 4.2 Zhao L, Liu F, Xu W, et al. Increased expression of OsSPX1 enhances cold/subfreezing tolerance in tobacco and Arabidopsis thaliana[J]. Plant biotechnology journal, 2009, 7(6): 550-561.
- ↑ 5.0 5.1 5.2 Wang C, Wei Q, Zhang K, et al. Down-Regulation of OsSPX1 Causes High Sensitivity to Cold and Oxidative Stresses in Rice Seedlings[J]. PloS one, 2013, 8(12): e81849.
Structured Information
| Gene Name |
Os06g0603600 |
|---|---|
| Description |
Similar to Ids4-like protein |
| Version |
NM_001064548.1 GI:115468827 GeneID:4341465 |
| Length |
4422 bp |
| Definition |
Oryza sativa Japonica Group Os06g0603600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:24752547..24756968 |
| Sequence Coding Region |
24752765..24753222,24756265..24756397,24756499..24756795 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:24752547..24756968 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:24752547..24756968 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgaagtttgggaagagcctgagtagccagatcgtggagacgctcccggagtggcgggacaagttcttgtcgtacaaggatctcaagaagcggctcaagctgattggtgggggtgggggtggggaggagaggcaggcgaagcgggcacgcgttgcagcggatggcggcgaggaggaggccgccgccgcggcgatgacgcccgaggaggcgggcttcatgcggctcctggaggccgagctcgacaagttcaactccttcttcgtcgagaaggaggaggaatacatcatccgccagaaggagctgcaggacagggtggcgagggcggcggggagggagtcgaaggaggagctgatgcgggtgcgcaaggagatcgtcgacttccatggcgagatggtgctgctcgagaactacagcgccctcaactacaccggattagttaagattctcaagaagtatgacaagaggactggggctctgatccgtctgcctttcatccagaaagtgctacagcagcctttcttcaccactgacctcctgtacaagcttgtgaaacagtgtgaggccatgctggaccagcttctaccatcaaacgaactgtctgtatcgagtgaagatgggagaggcgatagcactaacgaggacaagccttcgaatcccagttcatccttggttaatggtggcactattccagagttagatgagatcgagtacatggaaagcatgtatatgaagggcacggtcgcggcgcttaggtctctgaaggagatccgaagcggaagctctactgttagtgcattctcattaccacctctccagggcgacagttcgccagaggagcagcaggaactgtggaataagattccggtgattgagcaggccgccaaatga</cdnaseq> |
| Protein Sequence |
<aaseq>MKFGKSLSSQIVETLPEWRDKFLSYKDLKKRLKLIGGGGGGEER QAKRARVAADGGEEEAAAAAMTPEEAGFMRLLEAELDKFNSFFVEKEEEYIIRQKELQ DRVARAAGRESKEELMRVRKEIVDFHGEMVLLENYSALNYTGLVKILKKYDKRTGALI RLPFIQKVLQQPFFTTDLLYKLVKQCEAMLDQLLPSNELSVSSEDGRGDSTNEDKPSN PSSSLVNGGTIPELDEIEYMESMYMKGTVAALRSLKEIRSGSSTVSAFSLPPLQGDSS PEEQQELWNKIPVIEQAAK</aaseq> |
| Gene Sequence |
<dnaseqindica>3747..4204#572..704#174..470#attcccatcgtctccttcctcctctcccccgcatatcctccgcctccctttcccccctctcctcctcaaccctatttcaccaccacctccaccgctgccgcggcgagaattcgatcggttcttggcagccgtagtgcagttttgtgcagttttcttctctcttgttgttgaggatgaagtttgggaagagcctgagtagccagatcgtggagacgctcccggagtggcgggacaagttcttgtcgtacaaggatctcaagaagcggctcaagctgattggtgggggtgggggtggggaggagaggcaggcgaagcgggcacgcgttgcagcggatggcggcgaggaggaggccgccgccgcggcgatgacgcccgaggaggcgggcttcatgcggctcctggaggccgagctcgacaagttcaactccttcttcgtcgagaaggaggaggaatacatcatccgccagaaggtgcggcggtgatcgatcgccatttgtgcttcggttcgaatcttcttcttcttctcgagtttcttggttctgatttgggaaatcgacgctgtgtgtgtcaggagctgcaggacagggtggcgagggcggcggggagggagtcgaaggaggagctgatgcgggtgcgcaaggagatcgtcgacttccatggcgagatggtgctgctcgagaactacagcgccctcaactacaccggtgagtgtcccagtccacgcacttccccacccgccgcatcgcaacacccgtagttttcagttttcacatgtctttcactaattatattattgcaaagggttcgttagctgttgcttatgttgtttgttaactcttcttggaatgttctgtgaattggggaggtagtaataagagaggttggaaaaactggttaacatagtagtttagtatccttattagaattttttttgattggggaggtagtaagagaggtagaaaaaaattggttaatatagtagtttattagtgttctcagaaaggtaatttagcacgcatcatagagcaggcaggagtaatggaagtttcctgaacataggtcaagaaataggcgacttattgtggttgtgggcagctatggtttcgcatgtccgctacgcagcactcgtgtcgctgtcaaggagaatggatccttgtatggcaattcagtgcgcacacgtttttgctctctattgatgaatggatacttgaggttgggctcagcagctaatgttgggggcactgtatataaacagtttgttttctcgtgcgagacaagcaatttatagtatggccacatgagtgctaacattgtttatggtggagcactctgttcctttctgctgcaatttgaaatggtaacagtgtgtcatgcatccttctatcgtgaacagattttcctttgactcgctataagaaggtactccctccatcccaagatataagtatttctagctatgaatttggacaactgtgtccagattcatagccaaaagttgctatattttgggtcggaggtagtatataacaattgtaaacaaataggtcaaaaaatttatccttttcaacaggctgtaatacagttcgtcaccaaccaaatggtgcatagaagtttctacaagaaatatttgactaataattgacttggtatcagatattatcttggcaatatttttcactaaaaatacagtctgattcagggttcacatgatgatgcagtagtgtgtagtatagtatagtgaccttgccctctactgcagtgttccatggtagtctggtagattatctgcttccttacctgtccactggcagcatatgcagtgcatatgcaaagtaatgatgtacaactgtactgctttgctatttttcggttggcctttgttatgccttaatgctgagtggttgattttcctctttatcaatgtgagattgtgagtggcttctaatatctggaaattttcattcctagcctgggggttacaggttaatcatacaactcaattaaatctaggtcggtttctgttggcagttgggacgaaaattactcacttgaatatgatgttagagcatcatttctatcataagctccatagttgttttagaaatattgatttagtaagcagggcagcgtatgcctcccctcaccaaatccaaaattaaattcactatgcatcatttcaaagattgcctgaaattccgtagatgcattaataatactatatgcacaatttgcaaaaagttgggtgtacagtcatctgcagttagataaataaattaacttgttctaaattcccaggaagcattcacgcctgaaatactgtagtagacaagtttgcaggctaatttttgcaatatgttataaactatttcaaagacatttatagtttttatttttagtacggcgcaaaatacatatttggtaaacgggggcacatgcttcattgccaaatatttttcatcagttgacgagtcttctgattaaaagtcatgcctaacgaaacaagaaagtgcaattcatgttacgtttgtgatttgcgttccagctattgaaaataaaagaaattagttttgcatatcatctaaagatatggtattgctcaacagaaatttgtgtagctaatttcatgatcttcattagttgactcttttatgcttagctgagatgtgattgatggtcctaactttgcatgctattcgtcatcctagtgcttctttagtggactactttttaaagtcagttttttgctagctgcaatgaacttgaggctaatgagtaccttggttactgtgttattatgtgcttgtggacaatggtttcggtggacgtactgtgaaccagtgacctgtgaccactctttgtatcagcatcttgcttttttctgtttttcctttgcaagatgcaagttgatggtgtcacagacctatatggctatattgggccaggttaacacacactaatttggggagtcgacttttcgaatgtgaacacattctaaagatgaggatgtcacacaaaaagtaaatttgttgttttgcatcatgcaagcttagtatgttttgctcaaccaacagaacagaatgcaagttgcatgcttcttatatgcctgaagccctgaactggaatgtgttactgttaataaccatcattggtgctttgcaactgcacaatacatttctgctgccattttgctcatatcatgctggtctatttcgtatgcttatgcgaataagaaactatattagtgttgtacaactgtctgaaagttttctggttatcatttgcaatatgaaatgttatcctatctcaaccaaattgactagcatctcctttagtggcaatgtggtaccctttacacatcactaccatgctagctttcctgatatgaaaatttactggaccatgcctcacgagaattcaggttcattagctagggatgtgacaagttacaaatggttttggtgcctcagacagacagatgccacagcctgtaagccatacaagggcgtattttctatttccatcagtttgggcagatatcacctaaactaaaatgtttagtctgattgaaccactagcaatagctcatgtcagttatccctgtttattctcttgagggaaaactctttaagaaaagttgtgatattggaagtggattggatgctatttgaaatttggaagatgtaactcttgtactttgttttagattttcaccagttgatacttacgttccatgttgctgtttacaggattagttaagattctcaagaagtatgacaagaggactggggctctgatccgtctgcctttcatccagaaagtgctacagcagcctttcttcaccactgacctcctgtacaagcttgtgaaacagtgtgaggccatgctggaccagcttctaccatcaaacgaactgtctgtatcgagtgaagatgggagaggcgatagcactaacgaggacaagccttcgaatcccagttcatccttggttaatggtggcactattccagagttagatgagatcgagtacatggaaagcatgtatatgaagggcacggtcgcggcgcttaggtctctgaaggagatccgaagcggaagctctactgttagtgcattctcattaccacctctccagggcgacagttcgccagaggagcagcaggaactgtggaataagattccggtgattgagcaggccgccaaatgacacgaccggcatttcactacatggttatgtacactgcatgaccttgatcttgacatttgctggagatagtaccggggatctcattcccctgtcatatattcagtaatttgtatgattccaggattcctaacagttgtaaaatggtggacatgttcagtatacattgtaaaatcatagaaacccatcataaccatcagacagaactgagatgttttgat</dnaseqindica> |
| External Link(s) |