Difference between revisions of "BGIOSGA019069"
(→Annotated Information: ''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.) |
|||
| (23 intermediate revisions by one other user not shown) | |||
| Line 1: | Line 1: | ||
Please input one-sentence summary here. | Please input one-sentence summary here. | ||
| + | ''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice. | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | ''WOX3'' funtions as a transcriptional repressor of ''YAB3''. | |
| + | |||
| + | The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis. | ||
| + | |||
| + | Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells. | ||
| + | |||
| + | In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth. | ||
===Expression=== | ===Expression=== | ||
| − | + | ''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity. | |
| + | |||
| + | Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''. | ||
| + | [[File:in situ detection of YAB3 and WOX3 transcripts.jpg]] | ||
===Evolution=== | ===Evolution=== | ||
| − | + | According to the phylogeny analysis of ''YABBY'' and ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3. | |
| + | [[File:Figure 1. Phylogeny analysis of YABBY and WOX families.jpg]] | ||
| − | + | ===Knowledge Extension=== | |
| + | Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.[[File:Figure1.jpg]] | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | 1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China. | |
| + | |||
| + | 2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France. | ||
| + | |||
| + | 3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. | ||
| + | |||
| + | 4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China. | ||
| − | == | + | ==Structured Information== |
| − | + | [[Category:Genes]][[Category:Oryza Sativa Indica Group]][[Category:Indica Chromosome 5]] | |
==Structured Information== | ==Structured Information== | ||
Latest revision as of 02:10, 12 May 2015
Please input one-sentence summary here.
WOX3, a rice WUSCHEL-LIKE HOMEOBOX gene, negatively regulates the rice YAB3 gene which is involved in the leaf development in rice.
Contents
Annotated Information
Function
WOX3 funtions as a transcriptional repressor of YAB3.
The YABBY family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. YABBY members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize FIL-related YABBY genes(ZmYAB9 and ZmYAB14) expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice YABBY genes have different funtions from YABBY members in Arabidopsis and in maize. Additionally, these rice YABBY genes have distinct funtiions. In particular, YAB3 contributes to the exclusion of KNOX expression from the leaves(KNOX genes are essencial for leaf development), that is YAB3 is required for the promotion of diffentiation during leaf organogenesis.
Transgenetic experiments show that overexpression of WOX3 represses YAB3 and repression of WOX3 by RNAi induces the expression of YAB3. Further sequence analysis and expression and DNA-binding studies showing WOX3 can actually bind to the WOX3-binding site in YAB3 reinforces the hypothesis that WOX3 has a function to control or limit the expression levels of YAB3 in leaves contributing to maintain the undifferentiated state of dividing cells.
In summary, a regulatory module of rice leaf development in which WOX3 represses YAB3 that in turn represses KNOX genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.
Expression
WOX3 and YAB3 are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.
Overexpression of WOX3 leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by YAB3 RNAi, along with ectopic expression of KNOX genes in leaves of the trangenic plants. These experiments with inducible WOX3 expression suggest that WOX3 directly regulated YAB3. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with WOX3 to function independently of YAB3/KNOX regulation. Meanwhile, repression of WOX3 induces YAB3 expression which reinforces the interaction between WOX3 and YAB3.
Evolution
According to the phylogeny analysis of YABBY and WOX families, OsWOX3 is highly homologous to Arabidopsis PRS gene and the maize dulicated NS1 and NS2 genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.
Knowledge Extension
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.
Labs working on this gene
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China.
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.
Structured Information
Structured Information
| Gene Name |
BGIOSGA019069 |
|---|---|
| Description |
Putative wuschel homeobox protein |
| Definition |
Oryza sativa Indica Group BGIOSGA019069, complete gene. |
| LocusTag |
WOX3 |
| Ensembl Transcript ID |
BGIOSGA019069-TA |
| Ensembl Protein ID |
BGIOSGA019069-PA |
| Length |
941 |
| Source |
Oryza sativa Indica Group ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:1033323..1034263 |
| Sequence Coding Region |
1033323..1033910,1033991..1034263 |
| Genome Context |
<gbrowseImage1> name=IndicaChromosome05:1033323..1034263 source=RiceIndica05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=IndicaChromosome05:1033323..1034263 source=RiceIndica05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG</cdnaseq> |
| Protein Sequence |
<aaseq>MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV</aaseq> |
| Gene Sequence |
<dnaseqindica>1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG</dnaseqindica> |
| External Link(s) |