Difference between revisions of "BGIOSGA034702"
(Created page with "{{IndicaGene|
GeneName = BGIOSGA034702|
Description = Putative uncharacterized protein|
Definition = Oryza sativa Indica Group BGIOSGA034702, complete gene.|
tag = OsI_349...") |
|||
| (2 intermediate revisions by one other user not shown) | |||
| Line 1: | Line 1: | ||
| + | Please input one-sentence summary here. | ||
| + | |||
| + | ==Annotated Information== | ||
| + | ===Function=== | ||
| + | Please input function information here. | ||
| + | |||
| + | ===Expression=== | ||
| + | Please input expression information here. | ||
| + | |||
| + | ===Evolution=== | ||
| + | Please input evolution information here. | ||
| + | |||
| + | You can also add sub-section(s) at will. | ||
| + | |||
| + | ==Labs working on this gene== | ||
| + | Please input related labs here. | ||
| + | |||
| + | ==References== | ||
| + | Please input cited references here. | ||
| + | |||
| + | ==Structured Information== | ||
| + | [[Category:Genes]][[Category:Oryza Sativa Indica Group]][[Category:Indica Chromosome 11]] | ||
| + | |||
| + | ==Annotated Information== | ||
| + | ===Function=== | ||
| + | Please input function information here. | ||
| + | |||
| + | ===Expression=== | ||
| + | Please input expression information here. | ||
| + | |||
| + | ===Evolution=== | ||
| + | Please input evolution information here. | ||
| + | |||
| + | You can also add sub-section(s) at will. | ||
| + | |||
| + | ==Labs working on this gene== | ||
| + | Please input related labs here. | ||
| + | |||
| + | ==References== | ||
| + | Please input cited references here. | ||
| + | |||
| + | ==Structured Information== | ||
{{IndicaGene| | {{IndicaGene| | ||
GeneName = BGIOSGA034702| | GeneName = BGIOSGA034702| | ||
Latest revision as of 03:15, 12 May 2015
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
BGIOSGA034702 |
|---|---|
| Description |
Putative uncharacterized protein |
| Definition |
Oryza sativa Indica Group BGIOSGA034702, complete gene. |
| LocusTag |
OsI_34914 |
| Ensembl Transcript ID |
BGIOSGA034702-TA |
| Ensembl Protein ID |
BGIOSGA034702-PA |
| Length |
333 |
| Source |
Oryza sativa Indica Group ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 11:770992..771324 |
| Sequence Coding Region |
770992..771324 |
| Genome Context |
<gbrowseImage1> name=IndicaChromosome11:770992..771324 source=RiceIndica11 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=IndicaChromosome11:770992..771324 source=RiceIndica11 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>ATGGCGGCGACAACCGCTGATCCAGCTGTAGAAGAAGGGCGGTGGGAGGCGCGGCTCCACCCAATGCGGACGTGGCGCGCGGTAGGAGATGCGAGTGGTGACACTGAGGAGGACGTTGTCAGGGAGGTCCCCCCACCTTACCCAATCCATGGCGGCCATCATCGGATGCCGCCGTCTTCGCTCCCTGCCACACCCGCTCTCTGCTTGCCCCCGCCGCGCTTCCTCTATCCCCGACATGCTGCTCCCCCCAACCGGTGGCAACCACCCAAAGCTCCCCACTGCCGTCCCCACCATCAGATGCCGCTCCTGAGGTTTCGAAAGCATAACTGGTAA</cdnaseq> |
| Protein Sequence |
<aaseq>MAATTADPAVEEGRWEARLHPMRTWRAVGDASGDTEEDVVREVPPPYPIHGGHHRMPPSSLPATPALCLPPPRFLYPRHAAPPNRWQPPKAPHCRPHHQMPLLRFRKHNW</aaseq> |
| Gene Sequence |
<dnaseqindica>1..333#ATGGCGGCGACAACCGCTGATCCAGCTGTAGAAGAAGGGCGGTGGGAGGCGCGGCTCCACCCAATGCGGACGTGGCGCGCGGTAGGAGATGCGAGTGGTGACACTGAGGAGGACGTTGTCAGGGAGGTCCCCCCACCTTACCCAATCCATGGCGGCCATCATCGGATGCCGCCGTCTTCGCTCCCTGCCACACCCGCTCTCTGCTTGCCCCCGCCGCGCTTCCTCTATCCCCGACATGCTGCTCCCCCCAACCGGTGGCAACCACCCAAAGCTCCCCACTGCCGTCCCCACCATCAGATGCCGCTCCTGAGGTTTCGAAAGCATAACTGGTAA</dnaseqindica> |
| External Link(s) |