Difference between revisions of "BGIOSGA033815"

From RiceWiki
Jump to: navigation, search
 
(7 intermediate revisions by 2 users not shown)
Line 20: Line 20:
  
 
==Structured Information==
 
==Structured Information==
Please input one-sentence summary here.
+
    [[Category:Genes]][[Category:Oryza Sativa Indica Group]][[Category:Indica Chromosome 11]]
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
 
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
 
==References==
 
Please input cited references here.
 
 
 
==Structured Information==
 
{{IndicaGene|
 
GeneName = BGIOSGA033815|
 
Description = Putative uncharacterized protein|
 
Definition = Oryza sativa Indica Group BGIOSGA033815, complete gene.|
 
tag = OsI_36468|
 
tid = BGIOSGA033815-TA|
 
pid = BGIOSGA033815-PA|
 
Length = 1042|
 
Source = Oryza sativa Indica Group
 
 
 
  ORGANISM  Oryza sativa Indica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Indica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:17282021..17283062|
 
CDS = 17282709..17283062,17282021..17282638|
 
GCID = <gbrowseImage1>
 
name=IndicaChromosome11:17282021..17283062
 
source=RiceIndica11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=IndicaChromosome11:17282021..17283062
 
source=RiceIndica11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>ATGGCGAGCTTGTCGGCGTCGCCGTCGGGGAGGCGGCTGTCGGAGCTGCTGGAGGAGAAGCAGGAGCCGTTCTACCTCGACCTTCACCTGCTGGAGAAGGGGTGCTCGCCGCGGCTGCTCGACGGCTACGACACCGCCGCCGCCGCCGCGGTCATGTGCTGGCCGGCGGCGGCGGCGGCCGGCGGCGGCAACGACGCCGCCGCGTCCGTGCTCAGGCGGCTCACCACCACCACCACCAAGAAGAAGAAGGAGGCGGCGGCGAGGGGCGCGGGCAAGAAGACGACGAAGAAGCCTGCGGCGGCGGCGGCGGCGGCCACCGGGCTCCTCCGCGTCCTCCTCTCCAAGATCCTCCACGTCGCCGGCGCCGCCGCCGCGCCGTCTCCGTGCTCGACCAAGCACCACCCGCTCGACGCCGCCGCCGCCGCCGACGAGAAGGAGGAGGAGATAGAGTACACCGACTCGGAGTCCGACGACGAGAAGCAGTTCAGCCCGGTGTCCGTGCTGGACCACCCGTTCGACTTCGAGAGCTCACCCATCCACAAGCGCTCGCCGTCGCGGGTGGCGCAGCCGCAGGGCTCGCCGAAGAACGCCATGGCGTTCGTCCGCGACCTCCTCGAGGCGGCGTACTCGCCGGCGCTGCTCACCCACCTCCTCTCCAAGACCGACGACCTCATCAACGCCACGGCCGACGCCGCCGCCGCCGCCGCCTCCGACGACGACGACGACGACGACTGCTGCTACCACCACGAGAGCGACGGCGGCGAGCTCGCCCCCGCCGCCGCGTACTGGGAGGCGCAGAGGGCGGAGCTAACCAGGGTGTCGGCGATGGTGGCGTCGGAGGTGCCGAGCTCGTCGCGGATCGGCGCCGCCGACGTGCGGCCGGAGCGGGACGGCGTCGGCGCCGACCTCGAGGCCGCCGTGCTCGACCAGCTCCTGCACGAGCTCGCCGTGGAGCTCGCCGGCGGCCGCTGA</cdnaseq>|
 
AA = <aaseq>MASLSASPSGRRLSELLEEKQEPFYLDLHLLEKGCSPRLLDGYDTAAAAAVMCWPAAAAAGGGNDAAASVLRRLTTTTTKKKKEAAARGAGKKTTKKPAAAAAAATGLLRVLLSKILHVAGAAAAPSPCSTKHHPLDAAAAADEKEEEIEYTDSESDDEKQFSPVSVLDHPFDFESSPIHKRSPSRVAQPQGSPKNAMAFVRDLLEAAYSPALLTHLLSKTDDLINATADAAAAAASDDDDDDDCCYHHESDGGELAPAAAYWEAQRAELTRVSAMVASEVPSSSRIGAADVRPERDGVGADLEAAVLDQLLHELAVELAGGR</aaseq>|
 
DNA = <dnaseqindica>1..354#425..1042#ATGGCGAGCTTGTCGGCGTCGCCGTCGGGGAGGCGGCTGTCGGAGCTGCTGGAGGAGAAGCAGGAGCCGTTCTACCTCGACCTTCACCTGCTGGAGAAGGGGTGCTCGCCGCGGCTGCTCGACGGCTACGACACCGCCGCCGCCGCCGCGGTCATGTGCTGGCCGGCGGCGGCGGCGGCCGGCGGCGGCAACGACGCCGCCGCGTCCGTGCTCAGGCGGCTCACCACCACCACCACCAAGAAGAAGAAGGAGGCGGCGGCGAGGGGCGCGGGCAAGAAGACGACGAAGAAGCCTGCGGCGGCGGCGGCGGCGGCCACCGGGCTCCTCCGCGTCCTCCTCTCCAAGATCCTCCACGTCAAGGCGGCTAGCAACGGGGAAGCCTGGTGGCGCTTCAATCGTCGGAGTCGATTCAGCTTCAAGTAAGGTCGCCGGCGCCGCCGCCGCGCCGTCTCCGTGCTCGACCAAGCACCACCCGCTCGACGCCGCCGCCGCCGCCGACGAGAAGGAGGAGGAGATAGAGTACACCGACTCGGAGTCCGACGACGAGAAGCAGTTCAGCCCGGTGTCCGTGCTGGACCACCCGTTCGACTTCGAGAGCTCACCCATCCACAAGCGCTCGCCGTCGCGGGTGGCGCAGCCGCAGGGCTCGCCGAAGAACGCCATGGCGTTCGTCCGCGACCTCCTCGAGGCGGCGTACTCGCCGGCGCTGCTCACCCACCTCCTCTCCAAGACCGACGACCTCATCAACGCCACGGCCGACGCCGCCGCCGCCGCCGCCTCCGACGACGACGACGACGACGACTGCTGCTACCACCACGAGAGCGACGGCGGCGAGCTCGCCCCCGCCGCCGCGTACTGGGAGGCGCAGAGGGCGGAGCTAACCAGGGTGTCGGCGATGGTGGCGTCGGAGGTGCCGAGCTCGTCGCGGATCGGCGCCGCCGACGTGCGGCCGGAGCGGGACGGCGTCGGCGCCGACCTCGAGGCCGCCGTGCTCGACCAGCTCCTGCACGAGCTCGCCGTGGAGCTCGCCGGCGGCCGCTGA</dnaseqindica>|
 
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA033815 EnsemblPlants:BGIOSGA033815]|
 
}}
 
[[Category:Genes]]
 
[[Category:Indica mRNA]]
 
[[Category:Oryza Sativa Indica Group]]
 
[[Category:Indica Genes]]
 
[[Category:Indica Chromosome 11]]
 
[[Category:Chromosome 11]]
 

Latest revision as of 03:33, 12 May 2015

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information