Difference between revisions of "BGIOSGA022311"
| (3 intermediate revisions by one other user not shown) | |||
| Line 1: | Line 1: | ||
| + | Please input one-sentence summary here. | ||
| + | |||
| + | ==Annotated Information== | ||
| + | ===Function=== | ||
| + | Please input function information here. | ||
| + | |||
| + | ===Expression=== | ||
| + | Please input expression information here. | ||
| + | |||
| + | ===Evolution=== | ||
| + | Please input evolution information here. | ||
| + | |||
| + | You can also add sub-section(s) at will. | ||
| + | |||
| + | ==Labs working on this gene== | ||
| + | Please input related labs here. | ||
| + | |||
| + | ==References== | ||
| + | Please input cited references here. | ||
| + | |||
| + | ==Structured Information== | ||
| + | [[Category:Genes]][[Category:Oryza Sativa Indica Group]][[Category:Indica Chromosome 6]] | ||
| + | |||
| + | ==Annotated Information== | ||
| + | ===Function=== | ||
| + | Please input function information here. | ||
| + | |||
| + | ===Expression=== | ||
| + | Please input expression information here. | ||
| + | |||
| + | ===Evolution=== | ||
| + | Please input evolution information here. | ||
| + | |||
| + | You can also add sub-section(s) at will. | ||
| + | |||
| + | ==Labs working on this gene== | ||
| + | Please input related labs here. | ||
| + | |||
| + | ==References== | ||
| + | Please input cited references here. | ||
| + | |||
| + | ==Structured Information== | ||
| + | Please input one-sentence summary here. | ||
| + | |||
| + | ==Annotated Information== | ||
| + | ===Function=== | ||
| + | Please input function information here. | ||
| + | |||
| + | ===Expression=== | ||
| + | Please input expression information here. | ||
| + | |||
| + | ===Evolution=== | ||
| + | Please input evolution information here. | ||
| + | |||
| + | You can also add sub-section(s) at will. | ||
| + | |||
| + | ==Labs working on this gene== | ||
| + | Please input related labs here. | ||
| + | |||
| + | ==References== | ||
| + | Please input cited references here. | ||
| + | |||
| + | ==Structured Information== | ||
Please input one-sentence summary here. | Please input one-sentence summary here. | ||
Latest revision as of 08:35, 12 May 2015
Please input one-sentence summary here.
Contents
- 1 Annotated Information
- 2 Labs working on this gene
- 3 References
- 4 Structured Information
- 5 Annotated Information
- 6 Labs working on this gene
- 7 References
- 8 Structured Information
- 9 Annotated Information
- 10 Labs working on this gene
- 11 References
- 12 Structured Information
- 13 Annotated Information
- 14 Labs working on this gene
- 15 References
- 16 Structured Information
- 17 Annotated Information
- 18 Labs working on this gene
- 19 References
- 20 Structured Information
- 21 Annotated Information
- 22 Labs working on this gene
- 23 References
- 24 Structured Information
- 25 Annotated Information
- 26 Labs working on this gene
- 27 References
- 28 Structured Information
- 29 Annotated Information
- 30 Labs working on this gene
- 31 References
- 32 Structured Information
- 33 Annotated Information
- 34 Labs working on this gene
- 35 References
- 36 Structured Information
- 37 Annotated Information
- 38 Labs working on this gene
- 39 References
- 40 Structured Information
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
BGIOSGA022311 |
|---|---|
| Description |
Putative uncharacterized protein |
| Definition |
Oryza sativa Indica Group BGIOSGA022311, complete gene. |
| LocusTag |
OS06G0148500 |
| Ensembl Transcript ID |
BGIOSGA022311-TA |
| Ensembl Protein ID |
BGIOSGA022311-PA |
| Length |
1640 |
| Source |
Oryza sativa Indica Group ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:2966979..2968618 |
| Sequence Coding Region |
2966979..2967125,2968520..2968618 |
| Genome Context |
<gbrowseImage1> name=IndicaChromosome06:2966979..2968618 source=RiceIndica06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=IndicaChromosome06:2966979..2968618 source=RiceIndica06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>ATGGTATCTAAACAACAGTCCTCAAGTTGGGCAGATTTCCAGCCAGAACTACTTGGTCTTGTCCTCAGGCGCCTCCCTTCGCACGCTGACCGTGTTCGATTAAGAGCAGTCTGCCGCCCATGGCGCTCCAATGCTGAGATGCAGTTTGTTGCTAAAATGATTGCAGTACAATGGTTGCAGTTTTACTACTTTTTCTTTTTTACCTTTTCACATCAGCAACGTGTATATGATTCGAAAGAAAAATAG</cdnaseq> |
| Protein Sequence |
<aaseq>MVSKQQSSSWADFQPELLGLVLRRLPSHADRVRLRAVCRPWRSNAEMQFVAKMIAVQWLQFYYFFFFTFSHQQRVYDSKEK</aaseq> |
| Gene Sequence |
<dnaseqindica>1..147#1542..1640#ATGGTATCTAAACAACAGTCCTCAAGTTGGGCAGATTTCCAGCCAGAACTACTTGGTCTTGTCCTCAGGCGCCTCCCTTCGCACGCTGACCGTGTTCGATTAAGAGCAGTCTGCCGCCCATGGCGCTCCAATGCTGAGATGCAGTTTGTCCCCCCTCCGCACCCATGGCGCTCCAATGGTCAGATGCAGCCTTTCCCCCCTCCGCTCCCATGGCTCGGCCTCCTTGATGGGACCTTTCTTGACATTGCATCTTGTACAATTTTTATTTGCCAGCCACCAGTTACTACTGATTCATCCAAGGGTAAGAAGCCATTAGAGTACATTGCCGATGTTGCCTTCTTTGATGGAAAGCTGTACGCCATTTCTAAGTCTCGCAATCTCTTAATCCTTGAGATCACTGGCAGCTCTGGAAAAAGCCAACAATCTTAGCTGCCGATTCCCTAATCAACTCCACGGACCATATCAGTGCTCGACCTAAAACCTTGCTCAAAGTCGTGGTGTATATTTGCAGGGAATATCTAGTTGAATGCAGAGGTAGGCTGTTGATGGTGACACGATATATACCTTCTGTGGCCCATCCGACAGGTCCCGATTACTATGAGCATTATCGAACTGCTGGATTTGAGGTCTTCGAGGCAGATTTGACCAACATACCTGGTCGATGGAGAAGGGTACATAATCTGGGCGGTCAGGCGTTGTTTGTTGGGAAACATTGCTCCAAGGCTTTCCCTGCTGGAGAATCTGGTGGTGCTCAAGAGGATTGCATCTATTTCATGTGTGACTATCCCCCACCAGGGTTTGCTGCGGATCCTCTTCGTGACTCTGGTGTGTACAACATGAGAGATGGGATGATCAAGCCTTTGCTGACAGGGATTGCAGCTGAGCTGCCACATCGTGTTGGCCAGAGTCGTCCGACTTGGCTTTTCCCCACGGACACAATGTGAACAGCTCATCTGAGGTTCCTTTTTAATGCTGTTTTGGGATGCTTGGATGTACCCGGGATCCTAATTTTTGCCTGCTAGTATGTCTTCTCTAGTAATTATCAACGGCCCTACTAATCTGCTGTCCTGTGAAACATTATAACTATCTCTGTCCTTTTTTTGCTTGACACTTAATGTGGTATTTACTATCCAAAAAACTTGAATTATCTGAATGCAATATCTGTGAATGCATTTATGCATGTACTTCGAACCAAGTTCATTCTCTATGTGTTTAGAGCATGCCATTTTATATATGCTGTGGAGCCACTGCCATCGGTTTAAACTGAGAAAATGCTGTGAAACTTTTTTTCTCTTTATTTCCCCCCTCCCTCGCACTTATTAAGTTTAGTTTTTATAACTGGTTCATGATCTTTGATGAGTTGTGGACCTGTGGTGCACCTCAAAATTATAAGATGGAAGTTTATCCCTTTTTGCCTGGTGAACAGTATATAATTTGGTTGTTCTTGTCTACTTGATGTCTCATCATCTTTTTTAAGGGAATTTTGTGTCTCATGATCACCAACCATAACAATATTTCTTTTTGCAAGCTCCATACATATTGTTGCTAAAATGATTGCAGTACAATGGTTGCAGTTTTACTACTTTTTCTTTTTTACCTTTTCACATCAGCAACGTGTATATGATTCGAAAGAAAAATAG</dnaseqindica> |
| External Link(s) |