|
|
| (8 intermediate revisions by one other user not shown) |
| Line 1: |
Line 1: |
| | Please input one-sentence summary here. | | Please input one-sentence summary here. |
| − |
| |
| − | BGIOSGA024803 gene derived from alleles of the generally cultivated evolution rice controls the prostrate growth of common wild rice, with the performance of upright growth and increasing spike grain number.
| |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| Line 15: |
Line 13: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | 1.State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and
| + | State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and |
| | Breeding, China Agricultural University, Beijing, 100094, China. | | Breeding, China Agricultural University, Beijing, 100094, China. |
| − | 2.MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology,Tsinghua University, Beijing, 100084, China.
| + | |
| − | 3.National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China.
| + | MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology, |
| − | 4.State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.
| + | Tsinghua University, Beijing, 100084, China. |
| | + | |
| | + | National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy |
| | + | of Sciences, 300 Fenglin Road, Shanghai 200032, China. |
| | + | |
| | + | State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China. |
| | | | |
| | ==References== | | ==References== |
| Line 25: |
Line 28: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{IndicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Indica Group]][[Category:Indica Chromosome 7]] |
| − | GeneName = BGIOSGA024803|
| |
| − | Description = Prostrate growth 1Putative uncharacterized protein|
| |
| − | Definition = Oryza sativa Indica Group BGIOSGA024803, complete gene.|
| |
| − | tag = OSJNBB0050B07.12|
| |
| − | tid = BGIOSGA024803-TA|
| |
| − | pid = BGIOSGA024803-PA|
| |
| − | Length = 504|
| |
| − | Source = Oryza sativa Indica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Indica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Indica Chromosome 7|Chromosome 7]]|
| |
| − | AP = Chromosome 7:2808627..2809130|
| |
| − | CDS = 2808627..2809130|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=IndicaChromosome07:2808627..2809130
| |
| − | source=RiceIndica07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=IndicaChromosome07:2808627..2809130
| |
| − | source=RiceIndica07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</cdnaseq>|
| |
| − | AA = <aaseq>MDPSSASWPAPASPPVELSLSLPAAAARNRDEAAPTAIVDGKQVRLFPCLFCAKTFRKSQALGGHQNAHRKERVAGGSWNPNVYGDGGGSASMPIASHGVTAAGSSTAADGRWCGGAASDDDTTAAPMPSLGSGSAALGAGAGFASTERGSSGGGVAGEELVLELGL</aaseq>|
| |
| − | DNA = <dnaseqindica>1..504#ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</dnaseqindica>|
| |
| − | Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA024803 EnsemblPlants:BGIOSGA024803]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Indica mRNA]]
| |
| − | [[Category:Oryza Sativa Indica Group]] | |
| − | [[Category:Indica Genes]]
| |
| − | [[Category:Indica Chromosome 7]] | |
| − | [[Category:Chromosome 7]]
| |
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and
Breeding, China Agricultural University, Beijing, 100094, China.
MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology,
Tsinghua University, Beijing, 100084, China.
National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy
of Sciences, 300 Fenglin Road, Shanghai 200032, China.
State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.
References
Please input cited references here.
Structured Information
