Difference between revisions of "BGIOSGA024803"

From RiceWiki
Jump to: navigation, search
 
(2 intermediate revisions by one other user not shown)
Line 13: Line 13:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
 +
State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and
 +
Breeding, China Agricultural University, Beijing, 100094, China.
 +
 +
MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology,
 +
Tsinghua University, Beijing, 100084, China.
 +
 +
National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy
 +
of Sciences, 300 Fenglin Road, Shanghai 200032, China.
 +
 +
State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.
  
 
==References==
 
==References==
Line 18: Line 28:
  
 
==Structured Information==
 
==Structured Information==
{{IndicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Indica Group]][[Category:Indica Chromosome 7]]
GeneName = BGIOSGA024803|
 
Description = Prostrate growth 1Putative uncharacterized protein|
 
Definition = Oryza sativa Indica Group BGIOSGA024803, complete gene.|
 
tag = OSJNBB0050B07.12|
 
tid = BGIOSGA024803-TA|
 
pid = BGIOSGA024803-PA|
 
Length = 504|
 
Source = Oryza sativa Indica Group
 
 
 
  ORGANISM  Oryza sativa Indica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Indica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:2808627..2809130|
 
CDS = 2808627..2809130|
 
GCID = <gbrowseImage1>
 
name=IndicaChromosome07:2808627..2809130
 
source=RiceIndica07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=IndicaChromosome07:2808627..2809130
 
source=RiceIndica07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</cdnaseq>|
 
AA = <aaseq>MDPSSASWPAPASPPVELSLSLPAAAARNRDEAAPTAIVDGKQVRLFPCLFCAKTFRKSQALGGHQNAHRKERVAGGSWNPNVYGDGGGSASMPIASHGVTAAGSSTAADGRWCGGAASDDDTTAAPMPSLGSGSAALGAGAGFASTERGSSGGGVAGEELVLELGL</aaseq>|
 
DNA = <dnaseqindica>1..504#ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</dnaseqindica>|
 
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA024803 EnsemblPlants:BGIOSGA024803]|
 
}}
 
[[Category:Genes]]
 
[[Category:Indica mRNA]]
 
[[Category:Oryza Sativa Indica Group]]
 
[[Category:Indica Genes]]
 
[[Category:Indica Chromosome 7]]
 
[[Category:Chromosome 7]]
 

Latest revision as of 09:26, 12 May 2015

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and Breeding, China Agricultural University, Beijing, 100094, China.

MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology, Tsinghua University, Beijing, 100084, China.

National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China.

State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.

References

Please input cited references here.

Structured Information