Difference between revisions of "BGIOSGA024803"

From RiceWiki
Jump to: navigation, search
(Created page with "{{IndicaGene| GeneName = BGIOSGA024803| Description = Prostrate growth 1Putative uncharacterized protein| Definition = Oryza sativa Indica Group BGIOSGA024803, complete gen...")
 
 
(12 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{IndicaGene|
+
Please input one-sentence summary here.
GeneName = BGIOSGA024803|
+
==Annotated Information==
Description = Prostrate growth 1Putative uncharacterized protein|
+
===Function===
Definition = Oryza sativa Indica Group BGIOSGA024803, complete gene.|
+
Please input function information here.
tag = OSJNBB0050B07.12|
 
tid = BGIOSGA024803-TA|
 
pid = BGIOSGA024803-PA|
 
Length = 504|
 
Source = Oryza sativa Indica Group
 
  
  ORGANISM  Oryza sativa Indica Group
+
===Expression===
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
Please input expression information here.
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Evolution===
|
+
Please input evolution information here.
Chromosome = [[:category:Indica Chromosome 7|Chromosome 7]]|
+
 
AP = Chromosome 7:2808627..2809130|
+
You can also add sub-section(s) at will.
CDS = 2808627..2809130|
+
 
GCID = <gbrowseImage1>
+
==Labs working on this gene==
name=IndicaChromosome07:2808627..2809130
+
State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and
source=RiceIndica07
+
Breeding, China Agricultural University, Beijing, 100094, China.
preset=GeneLocation
+
 
</gbrowseImage1>|
+
MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology,
GSID = <gbrowseImage2>
+
Tsinghua University, Beijing, 100084, China.
name=IndicaChromosome07:2808627..2809130
+
 
source=RiceIndica07
+
National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy
preset=GeneLocation
+
of Sciences, 300 Fenglin Road, Shanghai 200032, China.
</gbrowseImage2>|
+
 
CDNA = <cdnaseq>ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</cdnaseq>|
+
State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.
AA = <aaseq>MDPSSASWPAPASPPVELSLSLPAAAARNRDEAAPTAIVDGKQVRLFPCLFCAKTFRKSQALGGHQNAHRKERVAGGSWNPNVYGDGGGSASMPIASHGVTAAGSSTAADGRWCGGAASDDDTTAAPMPSLGSGSAALGAGAGFASTERGSSGGGVAGEELVLELGL</aaseq>|
+
 
DNA = <dnaseqindica>1..504#ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</dnaseqindica>|
+
==References==
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA024803 EnsemblPlants:BGIOSGA024803]|
+
Please input cited references here.
}}
+
 
[[Category:Genes]]
+
==Structured Information==
[[Category:Indica mRNA]]
+
    [[Category:Genes]][[Category:Oryza Sativa Indica Group]][[Category:Indica Chromosome 7]]
[[Category:Oryza Sativa Indica Group]]
 
[[Category:Indica Genes]]
 
[[Category:Indica Chromosome 7]]
 
[[Category:Chromosome 7]]
 

Latest revision as of 09:26, 12 May 2015

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and Breeding, China Agricultural University, Beijing, 100094, China.

MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology, Tsinghua University, Beijing, 100084, China.

National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China.

State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.

References

Please input cited references here.

Structured Information