Difference between revisions of "Os01g0643300"

From RiceWiki
Jump to: navigation, search
m (Function)
(Structured Information)
 
(8 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice gene ''Os01g0643300'' was reported as '''''OsPIN10a''''' in 2009<ref name="ref1"/>, '''''OsPIN3a''''' in 2010<ref name="ref2"/>, '''''OsPIN3t'''''  in 2012<ref name="ref3"/>, respectively.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
*Auxin efflux carrier OsPIN3t is involved in the drought stress response and drought tolerance.The phytohormone auxin plays a critical role in plant growth and development, and its spatial distribution largely depends on the polar localization of the PIN-FORMED (PIN) auxin efflux carrier family members. OsPIN3t is a putative auxin efflux carrier gene in rice and it acts in auxin polar transport and involved in the drought stress response in rice.Overexpression of OsPIN3t led to improved drought tolerance, and GUS activity significantly increased when OsPIN3tpro::GUS plants were subjected to 20% polyethylene glycol stress. <ref>Qian Zhang, Jingjing Li, Wenjiao Zhang, et al. The putative auxin efflux carrier OsPIN3t is involved in the drought stress response and drought tolerance.The Plant Journal, 2012, 72(5): 805-816.</ref>
+
*Two types of full-length cDNA of ''OsPIN3a'' were identified in the database. The second exon of the longer full-length cDNA of ''OsPIN3a'', whose exon–intron structure was similar to that of ''OsPIN3b'' and ''OsPIN1'' genes, was divided into two exons by an intron in the shorter full-length cDNA<ref name="ref2"/>.
 +
 
 +
*The phytohormone auxin plays a '''critical role in plant growth and development''', and its spatial distribution largely depends on the polar localization of the PIN-FORMED (PIN) auxin efflux carrier family members<ref name="ref3"/>.
 +
 
 +
*As a '''putative auxin efflux carrier gene''' in rice, ''OsPIN3t'' acts in '''auxin polar transport''' but is also involved in the '''drought stress response''' in rice, which suggests that a polar auxin transport pathway is involved in the regulation of the response to water stress in plants<ref name="ref3"/>.
 +
 
 +
*Bioinformatics studies suggest that ''OsPIN3t'' was presumed to be an '''auxin efflux carrier''' and '''a member of the PIN family'''. The ''OsPIN3t'' cDNA and genomic sequences comprise 1857 and 4307 nucleotides, respectively. The UniProtKB/Swiss-Prot database suggested that ''OsPIN3t'' has two isoforms that are produced by alternative splicingref name="ref3"/>.
 +
 
 +
 
 +
'''GO assignment(s):''' GO:0005554,[http://amigo.geneontology.org/amigo/term/GO:0016021 GO:0016021]
 +
 
 +
===Mutation===
 +
*''OsPIN3t''pro::GUS rice lines<ref name="ref3"/>:
 +
**GUS activity '''increased''' strikingly with NAA treatment and '''decreased''' significantly with NPA treatment.
 +
**The GUS staining in the coleoptile of ''OsPIN3t''pro::GUS rice lines strongly '''increased''' after treatment with 50 nM NAA and '''decreased''' distinctly after treatment with 10 lM NPA. Similar results were observed in Arabidopsis by another group (Tsuda et al.,2011), which provides evidences that ''OsPIN3t'' is directly induced in response to auxin.
 +
*Homozygous OE
 +
*RNAi
 +
*WT
 +
**Their seeds were germinated in MS medium or MS medium supplemented with 5 lM NPA. After 5 days, more adventitious crown roots emerged from the WT and OE stems in MS medium, and fewer crown roots emerged from the plants subjected to NPA treatmentref name="ref3"/>.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*Different expression levels were also found between ''OsPIN10a'' and ''OsPIN10b''. ''OsPIN10a'' was '''highly''' expressed in '''all''' of the tested tissues, '''except for in root''', while relatively high expression was only found in leaf for ''OsPIN10b''<ref name="ref1"/>. ''OsPIN3a'' was expressed in '''leaf''', '''shoot apex''', '''panicle''' and '''callus''', but '''no''' expression was detected in '''root'''<ref name="ref2"/>.
 +
 
 +
*In '''flower organs''', ''OsPIN1a'' and ''OsPIN1c'', ''OsPIN5b'' and ''OsPIN10b'' were expressed in both vein of hull and anther; ''OsPIN5a'', ''OsPIN5b'', and ''OsPIN10a'' were expressed in '''anther''', and ''OsPIN1b'' and ''OsPIN2'' in vein of hull. ''OsPIN1b'' and ''OsPIN10a'' were also expressed in '''stigma'''<ref name="ref1"/>. ''OsPIN2'', ''OsPIN3a'' and ''OsPIN5a'' also showed '''slightly higher''' expression in an '''outermost cell layer'''<ref name="ref2"/>.
 +
 
 +
*For ''OsPIN10'', high expression of ''OsPIN10a'' was found in '''vascular tissues''' and '''relative low''' expression in '''pericycle cells and stele'''. Weak expression of ''OsPIN10b'' was observed in pericycle cells<ref name="ref1"/>. The tissue-specific expression patterns of ''OsPIN3t'' were also investigated using a b-glucuronidase(GUS) reporter, which showed that ''OsPIN3t'' was '''mainly''' expressed in '''vascular tissue'''. The GUS activity in ''OsPIN3t''pro::GUS plants '''increased''' by '''NAA''' treatment and '''decreased''' by '''NPA''' treatment<ref name="ref3"/>.
 +
 
 +
*''OsPIN1c'', ''OsPIN5a'', ''OsPIN10a'', and ''OsPIN10b'' were '''induced by JA'''. ''OsPIN5b'', ''OsPIN9'', ''OsPIN10a'', and ''OsPIN10b'' were '''induced by 6-BA'''<ref name="ref1"/>. '''Knockdown''' of ''OsPIN3t'' caused '''crown root abnormalities''' in the '''seedling stage''' that could be phenocopied by treatment of wild-type plants with NPA, which indicated that ''OsPIN3t'' is involved in the control of polar auxin transport. '''Overexpression''' of ''OsPIN3t'' led to improved '''drought tolerance''', and '''GUS activity''' significantly '''increased''' when OsPIN3tpro::GUS plants were subjected to 20% polyethylene glycol stress<ref name="ref3"/>.
 +
 
 +
===Subcellular localization===
 +
''OsPIN3t''–GFP fusion proteins are localized in '''plasma membranes''', and this subcellular localization '''changes under''' 1-N-naphthylphthalamic acid ('''NPA''') treatment<ref name="ref3"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File: OsPIN3t Phylogenetic1.jpg|right|thumb|300px|'''Figure 1.''' ''Phylogenetic Analysis between Arabidopsis AtPIN and Rice OsPIN Proteins.(from reference <ref name="ref1"/>).'']]
 +
*Four OsPINs(designated as OsPIN1a–d) were clustered with ''AtPIN1'', while the previously reported ''OsPIN4'' clustered with ''AtPIN3'', 4, and 7 was not found (Figure 1A). Two new members of the PIN family, one centered to PIN5 (''OsPIN5c'') and one paired with ''AtPIN8'' (''OsPIN8''), were also found (Figure 1A)<ref name="ref1"/>.
 +
 
 +
*Hydropathy analyses of the ''OsPIN3t'' amino acid sequence showed that the protein contains '''three characteristic regions''' including two mem_trans superfamilies, five hydrophobic stretches in the N-terminus, a predominantly hydrophilic core, and a hydrophobic region with five transmembrane segments, which showed similarity to ''OsPIN1b'', and these domains are found in all PIN and PIN-like proteins<ref name="ref3"/>.
 +
 
 +
*The OsPIN3t protein shares '''63% sequence identity''' with '''''AtPIN3''''' and '''61% sequence identity''' with '''''AtPIN4'''''<ref name="ref3"/>.  
  
You can also add sub-section(s) at will.
+
===Knowledge Extension===
 +
*Auxin is synthesized primarily in meristematic regions at the shoot apex and transported in a polar fashion to the root tip. An auxin signaling distal maximum and gradients in Arabidopsis root are recognized to be fundamental to cell fate and patterned root development<ref name="ref4"/>.
 +
*PIN proteins as efflux carriers of auxin mediate auxin acropetal flow to root tip through the central vasculature and basipetal flow through the epidermis<ref name="ref1"/><ref name="ref5"/><ref name="ref6"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zi Jin Gang Campus, Zhejiang University, Hangzhou, 310058, People’s Republic of China
 +
*Hebei Key Laboratory of Molecular and Cellular Biology, College of Life Sciences, Hebei Normal University, Shijiazhuang, Hebei 050024, China
 +
*State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou, Zhejiang 310006, China
 +
*Graduate School of Agricultural Science, Tohoku University, 1-1 Tsutsumidori-Amamiyamachi, Aoba-ku, Sendai 981-8555, Japan
  
 
==References==
 
==References==
#Qian Zhang, Jingjing Li, Wenjiao Zhang, et al. The putative auxin efflux carrier OsPIN3t is involved in the drought stress response and drought tolerance.The Plant Journal, 2012, 72(5): 805-816.
+
<references>
 +
* <ref name="ref1">
 +
Wang J R, Hu H, Wang G H, et al. Expression of PIN genes in rice (Oryza sativa L.): tissue specificity and regulation by hormones[J]. Molecular plant, 2009, 2(4): 823-831.
 +
</ref>
 +
* <ref name="ref2">
 +
Miyashita Y, Takasugi T, Ito Y. Identification and expression analysis of PIN genes in rice[J]. Plant science, 2010, 178(5): 424-428.
 +
</ref>
 +
* <ref name="ref3">
 +
Zhang Q, Li J, Zhang W, et al. The putative auxin efflux carrier OsPIN3t is involved in the drought stress response and drought tolerance[J]. The Plant Journal, 2012, 72(5): 805-816.
 +
</ref>
 +
* <ref name="ref4">
 +
Sabatini S, Beis D, Wolkenfelt H, et al. An auxin-dependent distal organizer of pattern and polarity in the Arabidopsis root[J]. Cell, 1999, 99(5): 463-472.
 +
</ref>
 +
* <ref name="ref5">
 +
Friml J, Vieten A, Sauer M, et al. Efflux-dependent auxin gradients establish the apical–basal axis of Arabidopsis[J]. Nature, 2003, 426(6963): 147-153.
 +
</ref>
 +
* <ref name="ref6">
 +
Rashotte A M, Brady S R, Reed R C, et al. Basipetal auxin transport is required for gravitropism in roots of Arabidopsis[J]. Plant Physiology, 2000, 122(2): 481-490.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os01g0643300|
 
Description = Similar to Auxin efflux carrier protein|
 
Version = NM_001050227.1 GI:115438824 GeneID:4326565|
 
Length = 4307 bp|
 
Definition = Oryza sativa Japonica Group Os01g0643300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:27619806..27624112|
 
CDS = 27619913..27621032,27621135..27621190,27621278..27621483,27622157..27622242,27622380..27622537<br>,27623627..27623703,27623794..27623860|
 
GCID = <gbrowseImage1>
 
name=NC_008394:27619806..27624112
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:27619806..27624112
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgatatccgggcacgacttctacacggtgatggcggcggtggtgccgctgtacgtggcgatgttcctggcgtacgggtcggtgcggtggtggggcatcttcacgccggaccagtgctccggcatcaaccgcttcgtcgccatcttcgccgtgccgctcctgtccttccacttcatctccaccaacgacccgtacgccatgaacctccgcttcctggcggcggacacgctgcagaagctgctcgtcctggcggggctcgccgcgtggtcgcgcctcccctcgcggaccggcgcgccgcggctggactggtccatcacgctcttctccctctccacgctgcccaacacgctcgtcatggggatcccgctgctgatcgccatgtacgggccatactccggctcgctcatggtccagatcgtcgtgctccagtgcatcatctggtacacgctgatgctcttcctcttcgagttccgcgccgcgcggatgctgatcgccgaccagttcccggacacggcggcgtccatcgtgtccctgcacgtcgacccggacgtggtgtcgctggagggcggccacgcggagacggaggccgaggtggcggcggacgggcggctgcacgtcaccgtgcgccggtcctcggtgtcgcggcggtcgctgctggtcacgccgcggccgtcgaacctgacgggagcggagatctactcgcttagctcgtcgcggaacccaaccccgcggggctccaacttcaaccacgccgacttcttcgccatggtcggcggcgggccaccgcccccgacgcccgctgcggtgcgcggctcgagcttcggcgcctccgagctctactcgctgcaatcgtcgcggggcccaaccccgaggcagtccaacttcgacgagcactcggcacggccgccgaaaccaccggcaacgaccacgggggcactcaaccacgatgccaaggagctccacatgttcgtgtggagctcgagcgcgtctcccgtctcagaagtcagcggcctgcctgtgttcagtggcggcggcggcggcggcgctctcgacgtcggcgccaaggaaatccacatggtcatccccgccgacctgccgcagaacaacggctcaggcaaagagcacgaggagtacggcgcagtggcattgggtggcggcggcggcggagagaacttcagctcgacggcggagctgcacccgaaggtcgtcgacgtcgacggaccgaacgccggcggcggcgccgcgggcgcggggcagtaccaaatgccgccggcgagcgtgatgacacgcctcatcctcataatggtgtggcgcaagctcatccgcaaccccaacacttactccagcctcctcggcctcgcctggtccctcgtcgccttccggtggcacgtctccatgccagcaatcgtcgagaagtccatctccattctctcggacgcaggcctggggatggccatgtttagcctgggattgttcatggcgctgcagcccagcatcatcgcgtgtggcaaatcagccgccgtcgtctccatggccgtccgcttcctcgcgggccctgccgtcatggccgccgcgtcaatcgccatcggactccgcgggacgctcctgcacgtcgccattgttcaggcggctctaccacaagggattgtgccttttgtttttgcaaaagaatacaatgtccacccggccatcctgagcacagcggtaatttttggcatgctaatagctcttccaatcacattgctgtactacatccttcttggactatga</cdnaseq>|
 
AA = <aaseq>MISGHDFYTVMAAVVPLYVAMFLAYGSVRWWGIFTPDQCSGINR                    FVAIFAVPLLSFHFISTNDPYAMNLRFLAADTLQKLLVLAGLAAWSRLPSRTGAPRLD                    WSITLFSLSTLPNTLVMGIPLLIAMYGPYSGSLMVQIVVLQCIIWYTLMLFLFEFRAA                    RMLIADQFPDTAASIVSLHVDPDVVSLEGGHAETEAEVAADGRLHVTVRRSSVSRRSL                    LVTPRPSNLTGAEIYSLSSSRNPTPRGSNFNHADFFAMVGGGPPPPTPAAVRGSSFGA                    SELYSLQSSRGPTPRQSNFDEHSARPPKPPATTTGALNHDAKELHMFVWSSSASPVSE                    VSGLPVFSGGGGGGALDVGAKEIHMVIPADLPQNNGSGKEHEEYGAVALGGGGGGENF                    SSTAELHPKVVDVDGPNAGGGAAGAGQYQMPPASVMTRLILIMVWRKLIRNPNTYSSL                    LGLAWSLVAFRWHVSMPAIVEKSISILSDAGLGMAMFSLGLFMALQPSIIACGKSAAV                    VSMAVRFLAGPAVMAAASIAIGLRGTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILS                    TAVIFGMLIALPITLLYYILLGL</aaseq>|
 
DNA = <dnaseqindica>108..1227#1330..1385#1473..1678#2352..2437#2575..2732#3822..3898#3989..4055#aagaagccactccactcggccgctcctgcatgtataactagctagttctagctcgctcaggcactcgatccaccgccgggcgcgttggattgagataggctgaggagatgatatccgggcacgacttctacacggtgatggcggcggtggtgccgctgtacgtggcgatgttcctggcgtacgggtcggtgcggtggtggggcatcttcacgccggaccagtgctccggcatcaaccgcttcgtcgccatcttcgccgtgccgctcctgtccttccacttcatctccaccaacgacccgtacgccatgaacctccgcttcctggcggcggacacgctgcagaagctgctcgtcctggcggggctcgccgcgtggtcgcgcctcccctcgcggaccggcgcgccgcggctggactggtccatcacgctcttctccctctccacgctgcccaacacgctcgtcatggggatcccgctgctgatcgccatgtacgggccatactccggctcgctcatggtccagatcgtcgtgctccagtgcatcatctggtacacgctgatgctcttcctcttcgagttccgcgccgcgcggatgctgatcgccgaccagttcccggacacggcggcgtccatcgtgtccctgcacgtcgacccggacgtggtgtcgctggagggcggccacgcggagacggaggccgaggtggcggcggacgggcggctgcacgtcaccgtgcgccggtcctcggtgtcgcggcggtcgctgctggtcacgccgcggccgtcgaacctgacgggagcggagatctactcgcttagctcgtcgcggaacccaaccccgcggggctccaacttcaaccacgccgacttcttcgccatggtcggcggcgggccaccgcccccgacgcccgctgcggtgcgcggctcgagcttcggcgcctccgagctctactcgctgcaatcgtcgcggggcccaaccccgaggcagtccaacttcgacgagcactcggcacggccgccgaaaccaccggcaacgaccacgggggcactcaaccacgatgccaaggagctccacatgttcgtgtggagctcgagcgcgtctcccgtctcagaagtcagcggcctgcctgtgttcagtggcggcggcggcggcggcgctctcgacgtcggcgccaaggaaatccacatggtcatccccgccgacctgccgcagaacaacggctcaggcaaaggtccgtcccgacattaatgccgcagtagtagtactgtcacttaatcacgggctccatgtgcaactctaaacatagaccttcccaaattttctacattttcagagcacgaggagtacggcgcagtggcattgggtggcggcggcggcggagagaacttcagcttcggaggcggcaagacggtggacggcgccgaggcagtagacgaggaggcggccttgcctgacgggctgacgaagatggggtcgagctcgacggcggagctgcacccgaaggtcgtcgacgtcgacggaccgaacgccggcggcggcgccgcgggcgcggggcagtaccaaatgccgccggcgagcgtgatgacacgcctcatcctcataatggtgtggcgcaagctcatccgcaaccccaacacttactccagcctcctcggcctcgcctggtccctcgtcgccttccggtacgccgttttttctttttccctctctccgaagattaacctacctttttcacgtgacctgtgcaattactcattttttctactgcctaagttagttcgggtgataaggtgatttcactcgacagagacgacaagttcggcgaggatcgaggaccgcgatggtgttggtgatgataagcgcgagagcgatattattctcggcgaagccagagggagtgggtagcgcgtaggcggtaggctaggaagcaccgaaactgcccgggggcgtacgtgccgtggcggtgggaataaccgaaaagcagcttttttacggatccccaaacggcggtggtgggccgacgaggtgagtgagtttcccgccggcacggaccaccgccgcgggcccggtcggcaccaatcgcgaactgtaggagctgaaaaaggcagaatttgcacggcgcgcgagcactggtcgtcgtcgagccagtctaccaaacacagtcacacaatagcgtttccaagcaaggaaccatgaacgattggccccgtttcctttggagtaacctgcatctactactactactaatcatcataagagcacacctgttgttattttatcatctctagtggctaatgatgttgatatttactgttccgggagctaaccaacgggcaatgtgttcatgggtcacaggtggcacgtctccatgccagcaatcgtcgagaagtccatctccattctctcggacgcaggcctggggatggccatgtttagcctgggtgggtgcccacgccccttgtgctcatgtcttcccgtagccctacaccgcattgctccgcaattaatccctcttcacacgcactggtgcccactggcccgcgctcgagctaacgctgtcaaactgtctcgtggccaggattgttcatggcgctgcagcccagcatcatcgcgtgtggcaaatcagccgccgtcgtctccatggccgtccgcttcctcgcgggccctgccgtcatggccgccgcgtcaatcgccatcggactccgcgggacgctcctgcacgtcgccattgttcaggtaactatgggttggtttggtttgtggcctaaatacatcttactaaattttgtcaatactaaattttggcaagttttagcatgactaattttggtaaagcaaagttgtgtttggattgaagccaaaatagcctaagttcactattgaaatggcctattttttaggcatgccaaaatttggcttcaaaccaaatagacactaaatactattgaaattgataaatattggtaagcctaatttagatctcaaaccaaaccagtcctatatgcatgcatctaaaagaagttactacagtaagcaacccgtgcaaagtgataatttaatttctcccttatgccaattataaaatttggtagacaagcttatcatgtgtgggggcgtttggctttgccagcagcgtatacagggtcggggttctgatctgtcagaccctggcttatatactctgggcctgtttggcacagctccagctccacccctcctggagtcaaacagtttcagctccactagaactgagctagagctcagtcaaacagtttcagctccaccagaactgggaatggagctgggtagagttctctcacaaaataaactagagttgtggagctaggtttaggcaactccacaactccactccagactcaactcctggagttaaatttaggagttggagctgtaccaaacaggccctccgtatatatgattccatcagcttctttactggaacatatgtactccctccgtcccataataggtgacgtttttgactttttatttgcaacgtttgaccattcattttatttgaaaaatcagtgcaaatataaaaaaaagataagtcatatgtaaagtacttttgataataaagcaaatgacaaacaaaataaataataatttcaaaattttttgaataagacgaatgatcaaacattgataaaaaaactcaaaaagacaagtaatatgggacggaggtagtacttactggagtagtatcaatcattcgagcaatttatttccctgtgcattatatactactagtatatgtgaagctaatgctcattgatatatatatctgggaattcgatttgataggcggctctaccacaagggattgtgccttttgtttttgcaaaagaatacaatgtccacccggccatcctgagcacagcgtaagcaatttcctttgcttgttttgcttgctgatatttttgtttggatggtgtttatatttattctgggcaaattgtcactttttacagggtaatttttggcatgctaatagctcttccaatcacattgctgtactacatccttcttggactatgatcaagaaagcttatggacgctctcacataaaacggaagaaatgggggcaaagagagagaaaaaaaagcgatcctgtccatctcaaacagcgtatgcttatatgtatagcctgttgtcggacattgcccatgatgacaagacaacgaagttgttacagagctatatatctctgcgacatttgtacaagagataacgacagaatgtactcaaatataaccgatattagatatgtgttctgttaaagatctcaac</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050227.1 RefSeq:Os01g0643300]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:22, 13 May 2015

The rice gene Os01g0643300 was reported as OsPIN10a in 2009[1], OsPIN3a in 2010[2], OsPIN3t in 2012[3], respectively.

Annotated Information

Function

  • Two types of full-length cDNA of OsPIN3a were identified in the database. The second exon of the longer full-length cDNA of OsPIN3a, whose exon–intron structure was similar to that of OsPIN3b and OsPIN1 genes, was divided into two exons by an intron in the shorter full-length cDNA[2].
  • The phytohormone auxin plays a critical role in plant growth and development, and its spatial distribution largely depends on the polar localization of the PIN-FORMED (PIN) auxin efflux carrier family members[3].
  • As a putative auxin efflux carrier gene in rice, OsPIN3t acts in auxin polar transport but is also involved in the drought stress response in rice, which suggests that a polar auxin transport pathway is involved in the regulation of the response to water stress in plants[3].
  • Bioinformatics studies suggest that OsPIN3t was presumed to be an auxin efflux carrier and a member of the PIN family. The OsPIN3t cDNA and genomic sequences comprise 1857 and 4307 nucleotides, respectively. The UniProtKB/Swiss-Prot database suggested that OsPIN3t has two isoforms that are produced by alternative splicingref name="ref3"/>.


GO assignment(s): GO:0005554,GO:0016021

Mutation

  • OsPIN3tpro::GUS rice lines[3]:
    • GUS activity increased strikingly with NAA treatment and decreased significantly with NPA treatment.
    • The GUS staining in the coleoptile of OsPIN3tpro::GUS rice lines strongly increased after treatment with 50 nM NAA and decreased distinctly after treatment with 10 lM NPA. Similar results were observed in Arabidopsis by another group (Tsuda et al.,2011), which provides evidences that OsPIN3t is directly induced in response to auxin.
  • Homozygous OE
  • RNAi
  • WT
    • Their seeds were germinated in MS medium or MS medium supplemented with 5 lM NPA. After 5 days, more adventitious crown roots emerged from the WT and OE stems in MS medium, and fewer crown roots emerged from the plants subjected to NPA treatmentref name="ref3"/>.

Expression

  • Different expression levels were also found between OsPIN10a and OsPIN10b. OsPIN10a was highly expressed in all of the tested tissues, except for in root, while relatively high expression was only found in leaf for OsPIN10b[1]. OsPIN3a was expressed in leaf, shoot apex, panicle and callus, but no expression was detected in root[2].
  • In flower organs, OsPIN1a and OsPIN1c, OsPIN5b and OsPIN10b were expressed in both vein of hull and anther; OsPIN5a, OsPIN5b, and OsPIN10a were expressed in anther, and OsPIN1b and OsPIN2 in vein of hull. OsPIN1b and OsPIN10a were also expressed in stigma[1]. OsPIN2, OsPIN3a and OsPIN5a also showed slightly higher expression in an outermost cell layer[2].
  • For OsPIN10, high expression of OsPIN10a was found in vascular tissues and relative low expression in pericycle cells and stele. Weak expression of OsPIN10b was observed in pericycle cells[1]. The tissue-specific expression patterns of OsPIN3t were also investigated using a b-glucuronidase(GUS) reporter, which showed that OsPIN3t was mainly expressed in vascular tissue. The GUS activity in OsPIN3tpro::GUS plants increased by NAA treatment and decreased by NPA treatment[3].
  • OsPIN1c, OsPIN5a, OsPIN10a, and OsPIN10b were induced by JA. OsPIN5b, OsPIN9, OsPIN10a, and OsPIN10b were induced by 6-BA[1]. Knockdown of OsPIN3t caused crown root abnormalities in the seedling stage that could be phenocopied by treatment of wild-type plants with NPA, which indicated that OsPIN3t is involved in the control of polar auxin transport. Overexpression of OsPIN3t led to improved drought tolerance, and GUS activity significantly increased when OsPIN3tpro::GUS plants were subjected to 20% polyethylene glycol stress[3].

Subcellular localization

OsPIN3t–GFP fusion proteins are localized in plasma membranes, and this subcellular localization changes under 1-N-naphthylphthalamic acid (NPA) treatment[3].

Evolution

Figure 1. Phylogenetic Analysis between Arabidopsis AtPIN and Rice OsPIN Proteins.(from reference [1]).
  • Four OsPINs(designated as OsPIN1a–d) were clustered with AtPIN1, while the previously reported OsPIN4 clustered with AtPIN3, 4, and 7 was not found (Figure 1A). Two new members of the PIN family, one centered to PIN5 (OsPIN5c) and one paired with AtPIN8 (OsPIN8), were also found (Figure 1A)[1].
  • Hydropathy analyses of the OsPIN3t amino acid sequence showed that the protein contains three characteristic regions including two mem_trans superfamilies, five hydrophobic stretches in the N-terminus, a predominantly hydrophilic core, and a hydrophobic region with five transmembrane segments, which showed similarity to OsPIN1b, and these domains are found in all PIN and PIN-like proteins[3].
  • The OsPIN3t protein shares 63% sequence identity with AtPIN3 and 61% sequence identity with AtPIN4[3].

Knowledge Extension

  • Auxin is synthesized primarily in meristematic regions at the shoot apex and transported in a polar fashion to the root tip. An auxin signaling distal maximum and gradients in Arabidopsis root are recognized to be fundamental to cell fate and patterned root development[4].
  • PIN proteins as efflux carriers of auxin mediate auxin acropetal flow to root tip through the central vasculature and basipetal flow through the epidermis[1][5][6].

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zi Jin Gang Campus, Zhejiang University, Hangzhou, 310058, People’s Republic of China
  • Hebei Key Laboratory of Molecular and Cellular Biology, College of Life Sciences, Hebei Normal University, Shijiazhuang, Hebei 050024, China
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou, Zhejiang 310006, China
  • Graduate School of Agricultural Science, Tohoku University, 1-1 Tsutsumidori-Amamiyamachi, Aoba-ku, Sendai 981-8555, Japan

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Wang J R, Hu H, Wang G H, et al. Expression of PIN genes in rice (Oryza sativa L.): tissue specificity and regulation by hormones[J]. Molecular plant, 2009, 2(4): 823-831.
  2. 2.0 2.1 2.2 2.3 Miyashita Y, Takasugi T, Ito Y. Identification and expression analysis of PIN genes in rice[J]. Plant science, 2010, 178(5): 424-428.
  3. 3.0 3.1 3.2 3.3 3.4 3.5 3.6 3.7 3.8 Zhang Q, Li J, Zhang W, et al. The putative auxin efflux carrier OsPIN3t is involved in the drought stress response and drought tolerance[J]. The Plant Journal, 2012, 72(5): 805-816.
  4. Sabatini S, Beis D, Wolkenfelt H, et al. An auxin-dependent distal organizer of pattern and polarity in the Arabidopsis root[J]. Cell, 1999, 99(5): 463-472.
  5. Friml J, Vieten A, Sauer M, et al. Efflux-dependent auxin gradients establish the apical–basal axis of Arabidopsis[J]. Nature, 2003, 426(6963): 147-153.
  6. Rashotte A M, Brady S R, Reed R C, et al. Basipetal auxin transport is required for gravitropism in roots of Arabidopsis[J]. Plant Physiology, 2000, 122(2): 481-490.

Structured Information