Difference between revisions of "Os01g0822900"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Structured Information)
 
(4 intermediate revisions by one other user not shown)
Line 27: Line 27:
  
 
*There is a big difference with the length of the third-leaf sheath between ''Psd1'' and ''ZH11'' plants.(Table.1)
 
*There is a big difference with the length of the third-leaf sheath between ''Psd1'' and ''ZH11'' plants.(Table.1)
 +
 +
*Average cell number and size are of obvious difference. Transverse sections of elongated internodes of ''Psd1'' and ''ZH11'' showed that the structure of parenchyma cells and vascular bundles of ''Psd1'' was different from ''ZH11'', the average number of cells and the cell size of the internodes were also different. All together, cell division and elongation were impaired in the ''Psd1'' mutant.
  
 
[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎|right|thumb|500px|'''Figure 3.'''  
 
[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎|right|thumb|500px|'''Figure 3.'''  
Line 34: Line 36:
 
[[File:Table1.jpg‎|right|thumb|500px|'''Table1.'''  
 
[[File:Table1.jpg‎|right|thumb|500px|'''Table1.'''  
 
''Length of the third-leaf sheath of ''Psd1'' and ''ZH11'' plants grown in dark and under light.'']]''
 
''Length of the third-leaf sheath of ''Psd1'' and ''ZH11'' plants grown in dark and under light.'']]''
 +
 +
[[File:Fig5_Cell_numbers_and_length.jpg‎|right|thumb|500px|'''Fig5.'''
 +
''Transverse sections of elongated internodes.'']]''
  
 
===Responses to GA and BR===
 
===Responses to GA and BR===
 +
 +
''Psd1''mutant respond to exogenous bioactive GA to a similar degree as wild-type rice, but exogenous GA could not rescue the dwarf phenotype. Also, the dwarf phenotype could not be rescued by exogenous BR.(Fig.4)
 +
Moreover, the sheaths of ''Psd1'' seedings could elongate to the similar length as ''ZH11'' under complete darkness, a phenotype different from that of BR-related mutants, in which sheaths could not elongate in the dark. These characterization suggest that Psd1 may not be deficient in the bio synthesis and perception of GA or BR.
 +
 +
[[File:FigQWE.jpg‎|left|thumb|500px|'''Fig4.'''
 +
''Length trend after the treatment with GA and BR .'']]''
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 54: Line 65:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os01g0822900|
 
Description = Similar to Lipid transfer protein|
 
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
 
Length = 901 bp|
 
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:36885860..36886760|
 
CDS = 36886214..36886223,36886310..36886662|
 
GCID = <gbrowseImage1>
 
name=NC_008394:36885860..36886760
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:36885860..36886760
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
 
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY                    VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC                    NVSLPYKISTSVNCNAIN</aaseq>|
 
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
 
}}
 
  
 
[[Category:Genes]]
 
[[Category:Genes]]

Latest revision as of 07:36, 13 May 2015

Please input one-sentence summary here.

Annotated Information

Function

  • A rice Dwarf 1 gene was identified by using a map-based cloning strategy. Its recessive mutant allele photoperiod-sensitive dwarf 1(Psd) confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.[1]
  • Plant height is an important agronomic trait for crop architecture and yield. Dwarf mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. Dwarf mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the Dwarf(D1) gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice d1 mutant was classified as gibberellin-insensitive,[2] though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.


Genomic structure of the Psd1 locus.jpg (from reference [1]).

Expression

  • It is expressed in elongating stem, vegetative sheath and young inflorescence.

(1)Expression analysis of flowering-related genes, Hd3a, RFT1, Ehd1, Ghd7and DTH8 in the Psd1 mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so Psd1 mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

(2)Psd1-related genetic network is regulated by day-length dependent signals.

Figure 2. Expression analyses of five flowering-related genes of the Psd1 and ZH11 plants harvested at 12:00(from reference [1]).

Wide Type VS Mutant

  • we observed that the plant height of Psd1 mutant was increased when the plants were grown from August to October, the SD season with day-length of 12.9-11.6h. This suggested that the Psd1 phenotype might be affected by day-length, and the dwarf phenotype is suppressed under SD conditions. Therefore, Psd1 is a novel photoperiod-sensitive dwarf mutant.(Fig.3)
  • There is a big difference with the length of the third-leaf sheath between Psd1 and ZH11 plants.(Table.1)
  • Average cell number and size are of obvious difference. Transverse sections of elongated internodes of Psd1 and ZH11 showed that the structure of parenchyma cells and vascular bundles of Psd1 was different from ZH11, the average number of cells and the cell size of the internodes were also different. All together, cell division and elongation were impaired in the Psd1 mutant.
Figure 3. Phenotypic characterization of the Psd1 mutant and ZH11 wide-type plants grown in long-day and short-day.(from reference [1]).


Table1. Length of the third-leaf sheath of Psd1 and ZH11 plants grown in dark and under light.
Fig5. Transverse sections of elongated internodes.

Responses to GA and BR

Psd1mutant respond to exogenous bioactive GA to a similar degree as wild-type rice, but exogenous GA could not rescue the dwarf phenotype. Also, the dwarf phenotype could not be rescued by exogenous BR.(Fig.4) Moreover, the sheaths of Psd1 seedings could elongate to the similar length as ZH11 under complete darkness, a phenotype different from that of BR-related mutants, in which sheaths could not elongate in the dark. These characterization suggest that Psd1 may not be deficient in the bio synthesis and perception of GA or BR.

Fig4. Length trend after the treatment with GA and BR .

Labs working on this gene

  • Identification and characterization of the Psd1 mutant
  • responses of Psd1 mutant to GA and BR
  • Photoperiod sensitivity tests
  • Linkage analysis and gene mapping
  • RNA isolation and quantitative RT-PCR analysis
  • Expression analysis of flowering-related genes in the mutant.

References

  1. 1.0 1.1 1.2 1.3 Riqing Li, Jixing Xia, Yiwei Xu, Xiucai Zhao, Yao-Guang Liu, Yuanling Chen. Characterization and genetic mapping of a Photoperiod-sensitive dwarf1 locus in rice(Oryza sativa L.)[J] Theor Appl Genet, 2014, 127: 241-250.
  2. Mits unagas, Tashiro T, Yamaguti J. Rice gibberellin-insensitive dwarf mutant gene Dwarf 1 encodes the α-subunit of GTP-binding protein.[J] PNAS, 1999, 96: 10284-10289.

Structured Information