|
|
| (3 intermediate revisions by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | This gene encodes a putative rust resistance kinase Lr10, and its functions are unknown. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | This gene is characterized from the cultivar Nipponbare, and is postulated to encode a putative rust resistance kinase Lr10-like protein which belongs to <br />the protein kinase superfamily. Even though the functions of the gene are unknown, some functions can still be learned by homologous prediction. The <br />protein harbors Tyrosine potentiality, protein kinases by its PKc-like catalytic domain, and transferase activity. The protein also contains an <br />ATP-binding site and a substrate binding site.The Lr10-like protein is expressed to resist the infectious agent Magnaporthe grisea, also known as rice<br /> blast fungus. This fungus can cause causes a serious disease affecting rice,such as rice rotten neck, rice seedling blight and blast of rice[1]. |
| | + | |
| | + | ... Figure1 Rice blast[2] |
| | + | [[File: riceblast.jpeg|caption]] |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | The rice gene corresponding to Lr10 was mapped on rice chromosome 1, where it occurred in many copies[3]. The Lr10-like protein is expressed in the<br /> rice leaf, and the expresssion is regulated by a complex signal pathway net[4]. However, the regulation mechanism of LR-10 expression in rice is still <br />poorly known. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | The Lr-10 belong to a superfamily including over 50 members. The Lr10 gene originates from hexaploid wheat and is located on chromosome 1AS[4]. The<br /> Lr1 and Lr9 resistance gene in wheat is intensively researched, but the evolution is still in blank. |
| | + | |
| | | | |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| Line 17: |
Line 20: |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | [1]http://en.wikipedia.org/wiki/Magnaporthe_grisea#cite_note-5 .[[http://en.wikipedia.org/wiki/Magnaporthe_grisea#cite_note-5]] |
| | + | |
| | + | [2]http://www.oisat.org/pests/diseases/fungal/rice_blast.html. [[http://www.oisat.org/pests/diseases/fungal/rice_blast.html]] |
| | + | |
| | + | [3]Gallego F, Feuillet C, Messmer M, ''et al''.Comparative mapping of the two wheat leaf rust resistance loci Lr1 and Lr10 in rice and barley. Genome.1998 Jun;41(3):328-36.[PMID: 9729767] [[http://www.ncbi.nlm.nih.gov/pubmed/9729767]] |
| | + | |
| | + | [4]Catherine Feuillet, Silvia Travella, Nils Stein,et al.Map-based isolation of the leaf rust disease resistance gene Lr10 from the hexaploid wheat (Triticum aestivum L.) genome. PNAS.2003; 100(25): 15253–15258.PMCID: PMC299976. [doi: 10.1073/pnas.2435133100][[http://www.ncbi.nlm.nih.gov/pmc/articles/PMC299976/]] |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]] |
| − | GeneName = Os01g0117600|
| |
| − | Description = Protein kinase-like domain containing protein|
| |
| − | Version = NM_001048388.1 GI:115434189 GeneID:4326070|
| |
| − | Length = 2551 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0117600, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:993712..996262|
| |
| − | CDS = 993910..995048,995153..995322,995412..996223|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:993712..996262
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:993712..996262
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgaaatccaatgcatctcgtgcttctgccactcgtagaaagttctacttcttgcagaaatctctgcttgtctcttctttgcttgcggttgttgcagcagatgttgttggagcagggccaaaccagcagtgttttccttcctcctgtggtgatcttggcaacatatcctaccctttccgtcttgcaagcgattcacgcccgtgcgttggtactcttcgcccatggtacaacctctcatgtagcagtggcagggctaccattcagatcaacacacggacgtactatgtcaccagcatcaactatactggtgagatcttctcggttgtggatgccaccttgcaggatgatgatacaaacggcaccagctgccctcttcctcgctctgatcaccttccttacatcgattactggcctccgtatttgggggaaagttcaaccgattcttatggttttgtctatttggccactgcttcagacacttgggcatgctttgtgaattgttcccgagcaagaacagatactatgccctggtacaggccagttacatgtctacttcccaacaattcatttgtttttgtctcgtttgatgactgtgccgttggagagcttcaaccttcctgtcgatatttggccatgattcccgttgacagatggaatctaccggacaactcctcacagctacagaatgcaagttacacagatatcataggattcataaggaaaggatttagtgttcggtttccatatcgtcctgaccagtaccagagtcctcgtatgagcgccagggaatgcctgaaggattcaaacaggtacttcaaggagcgtatatctcatccaagcattctgaatttaacccgtgctattttctggagcgaaacaaactccgaagtagactgcggatatgaagttgccccccaaaaagataggatttttttgggaaccatagtatcggctattgatatcatcaaatttcatttcgttttattcaggttagtgttggggtcactggtggtattcatcttccttgcccacaagtactggaaaacaaggatcacgatcgacgcagtagagaagttccttcgaatgcagcagatgattggtccgacgaggtttgcctacacagacattattgcaatcacatcccattttcgagacaagctaggccagggaggctatggctctgtatataaaggtgtactgctcccgggtaatgtccatatcgctgtcaagatgctgactggtagctccagctgcaacggagatgagttcatcagtgaggtctcaaccattggaaggattcaccatgtcaatgtggtgcgtctggtcgggttttgctctgaagaaatgaggagggcacttgtgtacgagtacatgcctcgaggctctcttgacaagtacatcttctcgtcagagaagagtttctcctgggataagctgaatgagatcgctttgggcattgcaagagggatcaactacctgcatcagggctgcgagatgcagattctgcactttgacattaaacctcacaacatccttcttgacgataactttgtcccaaaggttgctgatttcggtcttgcgaagctatacccaagggataagagcttcgtccctgtgagcgctgcacgaggaaccgtgggctacatagctcccgagatgatctctcggagcttcggtgtcatatcaagcaaatccgatgtttatagcttcggaatgctactattggagatggctggaggaagaaggaatgcagatccaaatgcagcaaactcaagtcaagcttattatccatcacgggtgtacagggagctgactcggcgagaaacaagcgagatctctgacattgctgatatgcatgaactagagaagaagctttgcattgttggattgtggtgcattcagatgaggtcatgtgatcgaccgacgatgagcgaggtgatagagatgcttgaaggtggcagtgatgaactgcaggttcctccaaggccattcttctgtgatgatgagcaattccctggagtggagtcttacaatatgccatctgatctaactgcaatctccgaggagcatgaggacgacgacgacgaaagcatatgtctgttcgaaagctaccagtaa</cdnaseq>|
| |
| − | AA = <aaseq>MAKSNASRASATRRKFYFLQKSLLVSSLLAVVAADVVGAGPNQQ CFPSSCGDLGNISYPFRLASDSRPCVGTLRPWYNLSCSSGRATIQINTRTYYVTSINY TGEIFSVVDATLQDDDTNGTSCPLPRSDHLPYIDYWPPYLGESSTDSYGFVYLATASD TWACFVNCSRARTDTMPWYRPVTCLLPNNSFVFVSFDDCAVGELQPSCRYLAMIPVDR WNLPDNSSQLQNASYTDIIGFIRKGFSVRFPYRPDQYQSPRMSARECLKDSNRYFKER ISHPSILNLTRAIFWSETNSEVDCGYEVAPQKDRIFLGTIVSAIDIIKFHFVLFRLVL GSLVVFIFLAHKYWKTRITIDAVEKFLRMQQMIGPTRFAYTDIIAITSHFRDKLGQGG YGSVYKGVLLPGNVHIAVKMLTGSSSCNGDEFISEVSTIGRIHHVNVVRLVGFCSEEM RRALVYEYMPRGSLDKYIFSSEKSFSWDKLNEIALGIARGINYLHQGCEMQILHFDIK PHNILLDDNFVPKVADFGLAKLYPRDKSFVPVSAARGTVGYIAPEMISRSFGVISSKS DVYSFGMLLLEMAGGRRNADPNAANSSQAYYPSRVYRELTRRETSEISDIADMHELEK KLCIVGLWCIQMRSCDRPTMSEVIEMLEGGSDELQVPPRPFFCDDEQFPGVESYNMPS DLTAISEEHEDDDDESICLFESYQ</aaseq>|
| |
| − | DNA = <dnaseqindica>1215..2353#941..1110#40..851#atactactcggcaaggcaaatcctgccagactgggagccatggcgaaatccaatgcatctcgtgcttctgccactcgtagaaagttctacttcttgcagaaatctctgcttgtctcttctttgcttgcggttgttgcagcagatgttgttggagcagggccaaaccagcagtgttttccttcctcctgtggtgatcttggcaacatatcctaccctttccgtcttgcaagcgattcacgcccgtgcgttggtactcttcgcccatggtacaacctctcatgtagcagtggcagggctaccattcagatcaacacacggacgtactatgtcaccagcatcaactatactggtgagatcttctcggttgtggatgccaccttgcaggatgatgatacaaacggcaccagctgccctcttcctcgctctgatcaccttccttacatcgattactggcctccgtatttgggggaaagttcaaccgattcttatggttttgtctatttggccactgcttcagacacttgggcatgctttgtgaattgttcccgagcaagaacagatactatgccctggtacaggccagttacatgtctacttcccaacaattcatttgtttttgtctcgtttgatgactgtgccgttggagagcttcaaccttcctgtcgatatttggccatgattcccgttgacagatggaatctaccggacaactcctcacagctacagaatgcaagttacacagatatcataggattcataaggaaaggatttagtgttcggtttccatatcgtcctgaccagtaccagagtcctcgtatgagcgccagggaatgcctgaaggattcaaacaggttttttttcctcatgattctgtctatataaaaaagacgtgttcccttctcacttattaccccgtcttgtacaacggtgtgatttgcaggtacttcaaggagcgtatatctcatccaagcattctgaatttaacccgtgctattttctggagcgaaacaaactccgaagtagactgcggatatgaagttgccccccaaaaagataggatttttttgggaaccatagtatcggctattgatatcatcaaatttcatttcggtacgtacgaattacttgcttttaatcatcccatccgtgatattatgcgcgtctgaacatatatattctaacttatatacatgcatgttggtttgtttgagaagttttattcaggttagtgttggggtcactggtggtattcatcttccttgcccacaagtactggaaaacaaggatcacgatcgacgcagtagagaagttccttcgaatgcagcagatgattggtccgacgaggtttgcctacacagacattattgcaatcacatcccattttcgagacaagctaggccagggaggctatggctctgtatataaaggtgtactgctcccgggtaatgtccatatcgctgtcaagatgctgactggtagctccagctgcaacggagatgagttcatcagtgaggtctcaaccattggaaggattcaccatgtcaatgtggtgcgtctggtcgggttttgctctgaagaaatgaggagggcacttgtgtacgagtacatgcctcgaggctctcttgacaagtacatcttctcgtcagagaagagtttctcctgggataagctgaatgagatcgctttgggcattgcaagagggatcaactacctgcatcagggctgcgagatgcagattctgcactttgacattaaacctcacaacatccttcttgacgataactttgtcccaaaggttgctgatttcggtcttgcgaagctatacccaagggataagagcttcgtccctgtgagcgctgcacgaggaaccgtgggctacatagctcccgagatgatctctcggagcttcggtgtcatatcaagcaaatccgatgtttatagcttcggaatgctactattggagatggctggaggaagaaggaatgcagatccaaatgcagcaaactcaagtcaagcttattatccatcacgggtgtacagggagctgactcggcgagaaacaagcgagatctctgacattgctgatatgcatgaactagagaagaagctttgcattgttggattgtggtgcattcagatgaggtcatgtgatcgaccgacgatgagcgaggtgatagagatgcttgaaggtggcagtgatgaactgcaggttcctccaaggccattcttctgtgatgatgagcaattccctggagtggagtcttacaatatgccatctgatctaactgcaatctccgaggagcatgaggacgacgacgacgaaagcatatgtctgttcgaaagctaccagtaacttagtagcaagtacatttatgatgattgtttttacttaatttgtatgcccgttttgctgtctaaagttcaaatatgctgagatcgatatagtttttatgtttattgtaagtttgtagcacatataataaagtgagagcttgtaatatttaggagtgtatgcttaatctccacaagacagtattatgaataatcttct</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048388.1 RefSeq:Os01g0117600]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 1]]
| |
| − | [[Category:Chromosome 1]]
| |
This gene encodes a putative rust resistance kinase Lr10, and its functions are unknown.
Annotated Information
Function
This gene is characterized from the cultivar Nipponbare, and is postulated to encode a putative rust resistance kinase Lr10-like protein which belongs to
the protein kinase superfamily. Even though the functions of the gene are unknown, some functions can still be learned by homologous prediction. The
protein harbors Tyrosine potentiality, protein kinases by its PKc-like catalytic domain, and transferase activity. The protein also contains an
ATP-binding site and a substrate binding site.The Lr10-like protein is expressed to resist the infectious agent Magnaporthe grisea, also known as rice
blast fungus. This fungus can cause causes a serious disease affecting rice,such as rice rotten neck, rice seedling blight and blast of rice[1].
... Figure1 Rice blast[2]
Expression
The rice gene corresponding to Lr10 was mapped on rice chromosome 1, where it occurred in many copies[3]. The Lr10-like protein is expressed in the
rice leaf, and the expresssion is regulated by a complex signal pathway net[4]. However, the regulation mechanism of LR-10 expression in rice is still
poorly known.
Evolution
The Lr-10 belong to a superfamily including over 50 members. The Lr10 gene originates from hexaploid wheat and is located on chromosome 1AS[4]. The
Lr1 and Lr9 resistance gene in wheat is intensively researched, but the evolution is still in blank.
Labs working on this gene
Please input related labs here.
References
[1]http://en.wikipedia.org/wiki/Magnaporthe_grisea#cite_note-5 .[[1]]
[2]http://www.oisat.org/pests/diseases/fungal/rice_blast.html. [[2]]
[3]Gallego F, Feuillet C, Messmer M, et al.Comparative mapping of the two wheat leaf rust resistance loci Lr1 and Lr10 in rice and barley. Genome.1998 Jun;41(3):328-36.[PMID: 9729767] [[3]]
[4]Catherine Feuillet, Silvia Travella, Nils Stein,et al.Map-based isolation of the leaf rust disease resistance gene Lr10 from the hexaploid wheat (Triticum aestivum L.) genome. PNAS.2003; 100(25): 15253–15258.PMCID: PMC299976. [doi: 10.1073/pnas.2435133100][[4]]
Structured Information