Difference between revisions of "Os01g0217900"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(25 intermediate revisions by one other user not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Gene ''Ros1a'' encodes a DNA demethylase, Repressor of silence 1a(Ros1a), which mediates 5-methylcytosine(5-meC) DNA demethylation in rice. It is a bi-functional DNA glycosylases that not only recognize and remove 5-meC from double-stranded DNA, but also has lyase activity, which nicks double-stranded DNA at an abasic site. It plays animportant role in both male and female gametophytes development, fertilization and endosperm development.
+
Gene ''Ros1a'' encodes a DNA demethylase, Repressor of silence 1a(Ros1a), which mediates 5-methylcytosine(5-meC) DNA demethylation in rice. It is a bi-functional DNA glycosylases that not only recognize and remove 5-meC from double-stranded DNA, but also has lyase activity, which nicks double-stranded DNA at an abasic site. It plays animportant role in both male and female gametophytes development, fertilization and endosperm development.<ref name="ref1"/>
  
 
===Expression===
 
===Expression===
ROS1a is the longest gene of six putative DNA demethylase genes in the rice genome , comprising 17 exons that encode a protein with 1952 amino acids, and 5’ and 3’ UTRs of 73 and 607 bp, respectively.(figure1) ROS1a was toxic to a E. colidcm+ strain containing 5-meC in an ITG-dependent manner.
+
ROS1a is the longest gene of six putative DNA demethylase genes(ROS1a–d and DML3a and DML3b) in the rice genome , comprising 17 exons that encode a protein with 1952 amino acids, and 5’ and 3’ UTRs of 73 and 607 bp, respectively.(figure1) ROS1a was toxic to a E. colidcm+ strain containing 5-meC in an ITG-dependent manner.<ref name="ref1"/>
 +
ROS1a contains an endonuclease III domain with significant similarities to base excision DNA repair pro-teins in the HhH-GPD superfamily.<ref name="ref2"/>
 
[[File:Schematic representation of ROS1a.jpg]]
 
[[File:Schematic representation of ROS1a.jpg]]
  
===Evolution===
+
===Genetic characteristics===
Please input evolution information here.
+
ROS1a is expressed in the central cell of the female gametophyte and male gametophytes,but Ros1a null mutation is difficult to transmitted to progeny. Although the molecular mechanisms for the inability to transmit the paternal Ros1a allele null mutation are unknown, null mutated Ros1a pollen germinates less efficiently than does ROS1a pollen. Even in the presence of the wild-type paternal ROS1a allele, the maternal Ros1a allele null mutation could cause failure of early-stage endosperm development, resulting in incomplete embryo development, with embryogenesis producing irregular but viable embryos that fail to complete seed dormancy, implying non-equivalent maternal and paternal contribution of ROS1a in endosperm development. The paternal ros1a allele null mutation does not transmitted to progeny, presumably because of a male gametophytic defect(s) prior to fertilization.<ref name="ref1"/>
  
You can also add sub-section(s) at will.
+
==Labs working on this gene==
 +
1.National Institute for Basic Biology, Okazaki 444-8585, Japan
 +
 
 +
2.Graduate School of Science and Technology, Niigata University, Niigata 950-2181, Japan
  
==Labs working on this gene==
+
3.Graduate School of Nutritional and Environmental Sciences, Graduate School of Pharmaceutical Sciences, and Global Center of Excellence Program, University of Shizuoka, Shizuoka 422-8526, Japan
Please input related labs here.
 
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">Akemi Ono1, Katsushi Yamaguchi1, et al.(2012)A null mutation of ROS1a for DNA demethylation in rice is not transmittable to progeny.The Plant Journal (2012) 71, 564–574.</ref>
 +
<ref name="ref2">Zhizhong Gong, Teresa Morales-Ruiz, et al.(2002) ROS1, a Repressor of Transcriptional Gene Silencing in Arabidopsis, Encodes a DNA Glycosylase/Lyase.Cell, Vol. 111, 803–814, December 13, 2002.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0217900|
 
Description = Conserved hypothetical protein|
 
Version = NM_001185305.1 GI:297719744 GeneID:9271145|
 
Length = 3118 bp|
 
Definition = Oryza sativa Japonica Group Os01g0217900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:6451851..6454968|
 
CDS = 6451852..6451888,6453241..6453279,6454305..6454441|
 
GCID = <gbrowseImage1>
 
name=NC_008394:6451851..6454968
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:6451851..6454968
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>gtttactttggaacttcaattccgacaatatttaaaggtttgacaactgaagaaatacaacattgcttttggagaggatttgtgtgcgtgagaggctttgataggacatcaagagcacccagaccactgtatgcaagactccactttccagcaagcaaaattaccaggaataaaaaatctgcaggttctgctccaggaagagatgatgaatag</cdnaseq>|
 
AA = <aaseq>VYFGTSIPTIFKGLTTEEIQHCFWRGFVCVRGFDRTSRAPRPLY                    ARLHFPASKITRNKKSAGSAPGRDDE</aaseq>|
 
DNA = <dnaseqindica>2..38#1391..1429#2455..2591#tgtttactttggaacttcaattccgacaatatttaaaggtatttcactaataaattttgaccaagaataggatttttggcagcgccaaatgtgccactatctttattgtgtgaagtccattatgtgattgtaataatttgaatcaccaagaggactaaggcctgctttgggacatattacgagcagcttttgcttgcaaagaaaccagattctggtgccgcaccttctccgctcttctgccacccaagtccgtccaatacccctcattgagcgcttggatcctaaccccatctgccatcatgcatcatcctgctaacaactgcttccaccattgcctgtttctgttgttgggaggcactcacgctgcttgctatagtttaggttttctttgtgtcctgatttagatggaatttccagctgctgtcttttacataactagctaaatgtccgcgctttgctatggataatagaaaatatattataatattgtcaaataaattaaatatgttttatacgaaatgtgttaacaatccttttgctatagggaatattgaccttaatttgattttatatgtggctatccatttagatttgtttgtttttctaataataataagttcaagggctaatgtacaaaattgacaatgggagtaggtggggtggcagattcactgccaccaccactaccttcttttaaaggggtatatagatttgcagcagtggttgcttgatctgtgatttgaaatgtcaagtacacgctcatgcatcagcaccatatgtctacgctcctgacccaacatgcaaccaatgcaattgagggttggctctgatacaattactaatgtcctatatccaaaacaactataggcctatgaccaaacataattaataacctcgcttgcgcttttgtcctcacttgctccatgtaaaagggttaacccgaggttactatgttaggaatagctgggtttatgaaacggttcaactctcaactcctcatatagcactaattcatgtattgctgtcagcagtgatttgagttccagatcatgctcataagataggaccaaattgtccttactatctactccctccgtcccaaaatataaggtatttccggtcaaaatatcttatattttgggatggagggagtactatactacggacccaccaccaaatagtgccgcagaagagagagagagagagagaagagggggtgggggtgggggtgtatgggtgaaataagaatagtgccaagtatttgccaacaaatgaggcggtcaaatgtgtcacatcaattgggaagtatgtcagatcaactgaaaatttgattgggaaattattattcatgcaacaaagctgtacaactgatcccatgtttctatcgcaggtttgacaactgaagaaatacaacattgcttttggagaggtaatcatttttttttgtatgtacgttttggtttccataacaaagagagatgaagtgtataggtactatgtttactgacaaggataataatagtagcaagtatataggcagaggagcatgtctctattctaccagtattattactcataataactagtatatccttttttttgccatttcagctgatagctactctccagtcaaaatatttgccatctctattgaacttttcattgtcttctgaatgtatcttactcttggatcattaatatttcattttgtcacgatatagtggtataggacaataaaatcatgggaagtatttattttcatcaccaatctactcatataattttcaaatgacaattataaatatcttaaaaatatattgttagttgtcctgtataaaataattgtcacaccctagtccacagcgacaagaatttgtgtctacaggctagagtgagtactctagaagtatcttcataggaatcggaataaaatgccaatgtgaatgaacaaggatatcaagtataccctcaaaatctctagagaggattgcgtaaatatgtaggtgtaattaaacaattgtttcatatggagggttttcttaaaggaggtacaagacttatcaatatgggtaaagtagtttttatccataggcattgttggcagaaagctgcttagggtagaatgctactccctccgtcccacaatataagagattttgagtttttgcttgcaacgtttgaccactcggcttattcaaaaatttttgaaattattatttattttatttgtgacttactttattattcacagtactttaagtacaacttttcgttttttatatttgcaaaaaaaattgtataagacgagtggtcaaacgttgtacgcaaaaactcaaaatcccttatattgtgggacggagggagtacttatggatgccttttttgtccaagatgtcagtaacattttctttcagggatgtggatttttacttcttttttccctaactttttcaggatttgtgtgcgtgagaggctttgataggacatcaagagcacccagaccactgtatgcaagactccactttccagcaagcaaaattaccaggaataaaaaatctgcaggttctgctccaggaagagatgatgaataggccatctggaaaaccagaaaggaaataaagaggaggtacatatgatctgccagaagatcactgacctgaaatggatcgctgaccaataagttgccgtaggcaattcaattatttctggccatatacatctgctgaaagttatgaactccagccactgacgaattcgtggtgctggtattcttcggcaacatgatccatcatacagattctatgcttggttgttgcaagcaattcttatgcggtgacagttgctgctgatagggagaaaaggcatgtccggcggctcagcggctctaactgtactttcatatgagtggaaccgattgttgtacatgtgaaaagtttgccattcaaaatggtcattcatgttgttaggtcattcatgtagtcgatgtcaaattaatcatcaattatttgatttgattcattcacaagtttaattggctctagatacttgtgagctgcaggccagcaatgtcataatgtatgtcgggaaaaggtagatataaatcgtcagcatttacctg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001185305.1 RefSeq:Os01g0217900]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 04:36, 14 May 2015

Please input one-sentence summary here.

Annotated Information

Function

Gene Ros1a encodes a DNA demethylase, Repressor of silence 1a(Ros1a), which mediates 5-methylcytosine(5-meC) DNA demethylation in rice. It is a bi-functional DNA glycosylases that not only recognize and remove 5-meC from double-stranded DNA, but also has lyase activity, which nicks double-stranded DNA at an abasic site. It plays animportant role in both male and female gametophytes development, fertilization and endosperm development.[1]

Expression

ROS1a is the longest gene of six putative DNA demethylase genes(ROS1a–d and DML3a and DML3b) in the rice genome , comprising 17 exons that encode a protein with 1952 amino acids, and 5’ and 3’ UTRs of 73 and 607 bp, respectively.(figure1) ROS1a was toxic to a E. colidcm+ strain containing 5-meC in an ITG-dependent manner.[1] ROS1a contains an endonuclease III domain with significant similarities to base excision DNA repair pro-teins in the HhH-GPD superfamily.[2] Schematic representation of ROS1a.jpg

Genetic characteristics

ROS1a is expressed in the central cell of the female gametophyte and male gametophytes,but Ros1a null mutation is difficult to transmitted to progeny. Although the molecular mechanisms for the inability to transmit the paternal Ros1a allele null mutation are unknown, null mutated Ros1a pollen germinates less efficiently than does ROS1a pollen. Even in the presence of the wild-type paternal ROS1a allele, the maternal Ros1a allele null mutation could cause failure of early-stage endosperm development, resulting in incomplete embryo development, with embryogenesis producing irregular but viable embryos that fail to complete seed dormancy, implying non-equivalent maternal and paternal contribution of ROS1a in endosperm development. The paternal ros1a allele null mutation does not transmitted to progeny, presumably because of a male gametophytic defect(s) prior to fertilization.[1]

Labs working on this gene

1.National Institute for Basic Biology, Okazaki 444-8585, Japan

2.Graduate School of Science and Technology, Niigata University, Niigata 950-2181, Japan

3.Graduate School of Nutritional and Environmental Sciences, Graduate School of Pharmaceutical Sciences, and Global Center of Excellence Program, University of Shizuoka, Shizuoka 422-8526, Japan

References

  1. 1.0 1.1 1.2 Akemi Ono1, Katsushi Yamaguchi1, et al.(2012)A null mutation of ROS1a for DNA demethylation in rice is not transmittable to progeny.The Plant Journal (2012) 71, 564–574.
  2. Zhizhong Gong, Teresa Morales-Ruiz, et al.(2002) ROS1, a Repressor of Transcriptional Gene Silencing in Arabidopsis, Encodes a DNA Glycosylase/Lyase.Cell, Vol. 111, 803–814, December 13, 2002.

Structured Information