|
|
| (2 intermediate revisions by one other user not shown) |
| Line 1: |
Line 1: |
| | Please input one-sentence summary here. | | Please input one-sentence summary here. |
| − | | + | nyc1 is a recessive mutant in rice and it canretain green leaves during senescence. |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| Line 6: |
Line 6: |
| | The symbol of the gene “Os01g0227100” is NYC1. | | The symbol of the gene “Os01g0227100” is NYC1. |
| | nyc1 is a recessive mutant in rice, nyc1 was isolated as a stay-green mutant in the paddy field. nyc1 remains green until just before death in natural senescence and does not show yellowing.In nyc1, most light-harvesting complex II(LHCII )members are selectively retained during senescence, in contrast with the wild type. nyc1retains granal structure during senescence. | | nyc1 is a recessive mutant in rice, nyc1 was isolated as a stay-green mutant in the paddy field. nyc1 remains green until just before death in natural senescence and does not show yellowing.In nyc1, most light-harvesting complex II(LHCII )members are selectively retained during senescence, in contrast with the wild type. nyc1retains granal structure during senescence. |
| − | 1.Inhibition of LHCP Degradation in nyc1 | + | |
| − | In wild-type senescent leaves, the abundance of these protein complexes was reduced remarkably at 5 DDI;In nyc1, the abundances of chlorophyll abinding proteins, LHCP dimer (whose major component is LHCI), PSI reaction center complex, and CP43/47 were reduced to similar levels as in the wild type at 5 and 7 DDI, but the LHCP trimer and monomer were apparent even at 7 DDI.图 | + | 1.Inhibition of LHCP Degradation in nyc1. |
| | + | In wild-type senescent leaves, the abundance of these protein complexes was reduced remarkably at 5 DDI;In nyc1, the abundances of chlorophyll abinding proteins, LHCP dimer (whose major component is LHCI), PSI reaction center complex, and CP43/47 were reduced to similar levels as in the wild type at 5 and 7 DDI, but the LHCP trimer and monomer were apparent even at 7 DDI. |
| | + | |
| | 2.Inhibition of Degradation of Pigments Strongly Bound to LHCP in nyc1. | | 2.Inhibition of Degradation of Pigments Strongly Bound to LHCP in nyc1. |
| − | By 8 DDI, the amounts of most photosynthetic pigments exceptb-carotene were significantly reduced in the wild type. In nyc1, the degradation of not only chlorophyllaand chlorophyllbbut also neoxanthin and lutein was apparently inhibited. | + | By 8 DDI, the amounts of most photosynthetic pigments exceptb-carotene were significantly reduced in the wild type. In nyc1, the degradation of not only chlorophyllaand chlorophyllbbut also neoxanthin and lutein was apparently inhibited. |
| − | 3.NYC1 is Required for Proper Chloroplast Degeneration。 | + | |
| − | The grana stacks are stable during senescence innyc1, unlike in the wild type.
| + | 3. the degradation of chlorophyll b was severely inhibited and light-harvesting complex II was selectively retained during senescence, resulting in the retention of thylakoid grana even at a late stage of senescence. |
| | + | |
| | + | 4.The protein encoded by NYC1 is necessary for catalyzing the first step of chlorophyll b degradation. Analysis of the nyc1 mutant, which shows the stay-green phenotype, revealed that chlorophyll b degradation is required for the degradation of light-harvesting complex II and thylakoid grana in leaf senescence. |
| | + | |
| | | | |
| | ===Expression=== | | ===Expression=== |
| | Please input expression information here. | | Please input expression information here. |
| − | nyc1 was located between cleaved-amplified polymorphic sequence (CAPS) markers P0443E07.24 and P0452F10.5. Five genes were predicted in this≈40-kb region. One of them seems to encode a member of the short-chain dehydrogenase/reductase (SDR) family . Sequence analysis of thenyc1-1allele revealed a single base pair change, a G-to-A substitution, at the first exon/first intron junction, which may prevent splicing of the first intron and result in the early termination of translation. | + | nyc1 was located between cleaved-amplified polymorphic sequence (CAPS) markers P0443E07.24 and P0452F10.5. Five genes were predicted in this≈40-kb region. One of them seems to encode encodes a protein with 504 amino acids belonging to the SDR family.The amino acid sequence of NYC1 contains all important amino acid residues conserved in the classical SDR family, including a dinucleotide binding motif (TGXXXGXG) and a catalytic site (YXXXK). NYC1 has an Arg at key position 15 (180th amino acid) and another at key position 37 (202nd amino acid). Sequence analysis of the nyc1-1 allele revealed a single base pair change, a G-to-A substitution, at the first exon/first intron junction, which may prevent splicing of the first intron and result in the early termination of translation. |
| | ===Evolution=== | | ===Evolution=== |
| | Please input evolution information here. | | Please input evolution information here. |
| Line 35: |
Line 40: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]] |
| − | GeneName = Os01g0227100|
| |
| − | Description = Glucose/ribitol dehydrogenase family protein|
| |
| − | Version = NM_001049003.1 GI:115435419 GeneID:4327178|
| |
| − | Length = 6295 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0227100, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:7023277..7029571|
| |
| − | CDS = 7023363..7023680,7024607..7024685,7024796..7024931,7025304..7025378,7025493..7025688<br>,7025875..7025943,7026095..7026234,7026405..7026527,7027370..7027562<br>,7028852..7029037|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:7023277..7029571
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:7023277..7029571
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggccgccgccgcggtggtccacctctccgtgcacggccgcctccgccgctcgccggagctccacgcccggccataccaccgcccgtcgctgctccggtgccgcgcgttcaagcaggaggccgataacggcggggaggaggcttcgtcgtcgccgccgccgccgacgacggccgaggcgcggaggcgcaggaagggcccgctgtacaagctgaaggcggcgattcaggggctcgccgggtcgcggtcggcggccgcggaggcgtacgggggcgagtaccagcgcgccgtcgagaaggccgaggagatcttcttctcggttgctacgcaagtaggccgatatgttatcactatgatgagcagcggtgttgtacttggagttggatttcagttatcaggcggagacagccaaatgaatacactaatttggtatagttggctcgggggagtaattattggcacgatgataggtgcaaacagtgtcctagaggaacactgcaaagctggacctcgcaatgttgtcataactggaagcacaagaggattagggaaagcacttgctcgggagttccttctttctggagatcgtgttgtaattgcttcacgcagccctgaatcagtccttcagaccatcaacgagcttgaagagaacatacaggagggcttgtcagttgcgaaaaagaaacagagagaaattttgctacatgccaaggttgttggtacatcatgtgatgtttgtaaaccagaagatgtgaaaaagttggtgaactttgccaaggatgagcttggatcaattgatatttggataaataacgctggcacaaacaaaggttttaggccactggtaaacttttcagatgaagatatttctcagattgtctcaacaaacctagttggctctttactgtgcaccagagaagccatgaatgtcatgcaacaccaacaaaagggaggtcacgtatttaacatggatggagcaggttctggaggatcaagtacaccattaacagctgtttatggttcaactaagtgtggccttagacagtttcaagcatcacttctgaaggaaagcagaagatcaaaagttggtgtacacactgcttctcctggaatggtccttacggacctccttttgagcggttcttctctgagaaataaacagatgttcaatttaatatgtgagcttccagaaacagttgcaaggacattggttccgaggatgcgagttgtgaaaggaagtggaaaggcgataaactacttgacaccaccaaggatcttgcttgccttggttactgcatgggttcgccgaggccgatggtttgatgaagagggaagagcagtatatgcagcagaggctgatagaatccgtaattgggctgaaagtcgagcacgcttctctttcacagatgccatggagatgtacacagaaaacacatgggtttctgtgttctcgctctctgtcgtctgcgcattcataattctttccagctcaggtggacctcttccaggcacatga</cdnaseq>|
| |
| − | AA = <aaseq>MAAAAVVHLSVHGRLRRSPELHARPYHRPSLLRCRAFKQEADNG GEEASSSPPPPTTAEARRRRKGPLYKLKAAIQGLAGSRSAAAEAYGGEYQRAVEKAEE IFFSVATQVGRYVITMMSSGVVLGVGFQLSGGDSQMNTLIWYSWLGGVIIGTMIGANS VLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVIASRSPESVLQTINELEENI QEGLSVAKKKQREILLHAKVVGTSCDVCKPEDVKKLVNFAKDELGSIDIWINNAGTNK GFRPLVNFSDEDISQIVSTNLVGSLLCTREAMNVMQHQQKGGHVFNMDGAGSGGSSTP LTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDLLLSGSSLRNKQMFNLI CELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRRGRWFDEEGRAVYAA EADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSSSGGPLPGT</aaseq>|
| |
| − | DNA = <dnaseqindica>87..404#1331..1409#1520..1655#2028..2102#2217..2412#2599..2667#2819..2958#3129..3251#4094..4286#5576..5761#gccctctcctaaaaccaaggaacccaaccccacaaaaaagcgtaggacgccggagtgcgaaatccttatccgctcgcggcgacgccatggccgccgccgcggtggtccacctctccgtgcacggccgcctccgccgctcgccggagctccacgcccggccataccaccgcccgtcgctgctccggtgccgcgcgttcaagcaggaggccgataacggcggggaggaggcttcgtcgtcgccgccgccgccgacgacggccgaggcgcggaggcgcaggaagggcccgctgtacaagctgaaggcggcgattcaggggctcgccgggtcgcggtcggcggccgcggaggcgtacgggggcgagtaccagcgcgccgtcgagaaggccgaggagatcttcttctcggtgagctccattcctgaaccccctcaagctcccccgcaagcgcagtttctctacatgataatatgataatatgtttatggccgattttttcatctgatcgtgtgatctactagtacgactgcctttaattgttgccacgtatcgggaggctcaaccactcaatgcgttagcgagcgctactaccttaatcagctcttgcttagctgcatatgggaattgcacccatcagatgctacagctacaagtgagtttaggcgatctatgttgtttcaatgggtgttaggatccaatacactagctgtggcacaaatcgatgagctgatcaacactaatcagcttgtttcttactagtaatacagtaggctccagttactgtgaaattctgtaatgtcagttccctttatgtttatgtgctggagagcaaattctgcctgcgctaaaattaatcgcaggcctgtgaagcaatttgcctgggcagaggatgcggctcgtagccagaggtgtcattttgtgtagcctttgttgcttttgaaactattttaaacttctttgaaactcgctcttgattaaatttacttcgcccctcatttatatgggcctagattctctggttcttgcatctaccattgtatggggggcatgggctgccaggctcatggttttacatgtccgactgtaagtgcatgcacaggcctgctttatagttcaattgaattgcttcctaggcatgctgattctttgtattgatataaataaaatctccggtatcggctgattctctaacctaagcacatcagtaattttctatttgttgcaaacctgaacagagtggttctgaatttatcactactgagttgtaggatcaactccttttctgaaataggtgttctttttttcaaattgacttatttccttctccttttcaggttgctacgcaagtaggccgatatgttatcactatgatgagcagcggtgttgtacttggagttggatttcagttatcaggttagttacattcatttgatatattgcattgcctttggatacttctgtttttttccctacaatgggcattttcagagtttcagtaatgacctagctacctttctatttaggcggagacagccaaatgaatacactaatttggtatagttggctcgggggagtaattattggcacgatgataggtgcaaacagtgtcctagaggaacactgcaaagctggacctcgcaatgttgtcataactggaaggtaacccattttgcattcttcctttcacatgccatctgaatcttttgctaggaagcatgcatactgtgagtacaggtcaaaggtaataatcaaaactaatgaatttattcctagataggaaatactatttcaccttctattattctctattttcttatttgatgagtggagtataaccataacaatcaccaagtttatacgggttggtgcatagaggagattatgaggtgcagtcatatgaacaaatcattaaagtaacctcataaacatgttaatataaacatgacttctcattgcatcaattgtgagctgatttcttattagtatccatgttctgcaatcaacattgaagttatagtttgattttggcagcacaagaggattagggaaagcacttgctcgggagttccttctttctggagatcgtgttgtaattgcttcacgcaggtggtactcatagacatgtagctcaatgtgtgttgttgttgcatatccatgatattctttttatgaaatgcaatgcgttgtcctagttttaaatatcctattttttgaaggcagccctgaatcagtccttcagaccatcaacgagcttgaagagaacatacaggagggcttgtcagttgcgaaaaagaaacagagagaaattttgctacatgccaaggttgttggtacatcatgtgatgtttgtaaaccagaagatgtgaaaaagttggtgaactttgccaaggatgagcttggatcaattgatatttgggtaaataatttacttttacatatctatccccatcatttattctgcattatttcacggtagggtactcagttggatacttggattgagtgcacaagtttttgtacttataacctttttattttgttctgtactgtggcatcgcagaatgtacttaacatgtgctattcttcttattcttatgtatagataaataacgctggcacaaacaaaggttttaggccactggtaaacttttcagatgaagatatttctcaggtacgttaattatcttcggaaaatcagagtcttttccattctaatagagttcatagaactatattcgtcatgcaacctgacttagttatttcatcttatttttctttctgcttagcctaaacaacattattgtgtccttttctgtttgcagattgtctcaacaaacctagttggctctttactgtgcaccagagaagccatgaatgtcatgcaacaccaacaaaagggaggtcacgtatttaacatggatggagcaggttctggaggatcaagtacaccattaacagctgtgtaagtacctaatgatttcaaatttttaatgctccactgttcgtgtagctcttatactggacagggatattgtcttgtggtttcttcattggctaaaaacgagtataattgtattgatgttgttacttgtgcagtgaaactaaaactgatactattttgcaaacttgcagttatggttcaactaagtgtggccttagacagtttcaagcatcacttctgaaggaaagcagaagatcaaaagttggtgtacacactgcttctcctggaatggtccttacggacctccttttgaggtaacctctgaagttatttagatgcaattattgatgatttgcttgtttagttcattctgaacttcaatatatttattgcttggtgcacatgttgtccaaactccaaaccacactttgtgtgatgatagtaaaacaagataagacttcaagtgcataagaagttttcagtaggatctttatggaaccacacatattggttaatcagaatttcacgctatcttcattttgaatttattttagttaatcaacaatcagaatgtctcctttgttgaatggggaagagtcaaaattttgagatacctcgctgcccaaatcttctttgtttcaatctcttctttctaggatttgatttgtggcaactatttctgtagaatcagcttcacattaattattaagttgcttttgctactacacttctagctctggcttttcctatctgctataatcccgatgacacggtaaactgggtgcgtggcggttaatcagaacctgaaagaattaatgttccattcttgtgcaaatactctgccttgtaaatccagttcaaagttgtgatgttgcacatactttatacttgtaaggcttcatagtttctgtcaatatataaataacttgtgagataacttccagatataattattacaaatgactaatgcactggaaagttctaacatattaatattttttattggtaatactatatacggagaataatatgttttttaacttcaattgatggtgcatgccacttcttccatatttatctggtcagctcttctgttgccacatgcccaactatgcagactgctttagttaacttataatccttctatcttttgcagcggttcttctctgagaaataaacagatgttcaatttaatatgtgagcttccagaaacagttgcaaggacattggttccgaggatgcgagttgtgaaaggaagtggaaaggcgataaactacttgacaccaccaaggatcttgcttgccttggttactgcatgggttcgccgaggccgatggtttgatgaagaggtatgtttcttctctatgcagctagtacttttcagctttaccttttatttcagcaatgccagtatatgaaatatgctgaattcctgcagaagccatgcgtgcaaacatgattgttgttttcattattatgcatcttgcatgcacttttcatgatattgaacctcaagacttttgagctattatgcttctgaaatagtgaaatatacatttctagagaaagagtaccaagctcttctaccgttgcaccaaatgtatatgaaactcattgttgaatataaagaacaatggacatagactattcaaattatgcctgtggtgattttcttgtaaattatgctaaataagcagtattcgttctaagactggatcaaccaggcgagtcagatcataatgaagcttgagaccagtgtccagttctgtcaggtctctacataagtaagagccataaatagggtctgtcttgatggttcagtttccaggttcattatgaccagctcagtccatcacctttactgctagttggccagagctcttctggaaggccttaggctggtcctcccctcaatggcggcttcaaacacctggttccaccatggcttagctcggtccaacagtctcagtgctattgtttgtactgcatgttaaatatgacatagttaattctcacatgtattgctggatctcacctagtccacatgaaatccagcaacagatttaactggagagaatgataggggttttaaaaagcaactgcacccgtcaaatgattgcactctagtaatattttggggctgaaatgggcacaagtatacatattgacgttttttttggtatctcactggtttattggctgtgattttgggaaagaaaatcacctgcaaattttggtaccgtcgaagcttctcaccattagattgacaattattaatggaaaaactgaatgaacacatgtattattttcgcaagatatttaggaaacatgacatttgagaaaaaaaaatgctgagaagtgggtaataatttaattataacgtttgtgttccttcagaatctttcacaatataactgaagaaaagtgctgtatacatcagtgtcttttgtgatggacaatgctccaatcatcctatgtgcaaggttgaaaatcaaacagatgaagtaaaagaatattatattcttacaaatgagagatcagcataccaagcgactttatgcatacttcacagttcataatactttcagtctgatgattaattcatgtgaatgtgtgactgatcataagcacattgcagggaagagcagtatatgcagcagaggctgatagaatccgtaattgggctgaaagtcgagcacgcttctctttcacagatgccatggagatgtacacagaaaacacatgggtttctgtgttctcgctctctgtcgtctgcgcattcataattctttccagctcaggtggacctcttccaggcacatgatcccaggagttgccaaactagatggctacacacaccatttttcttcagtacggggattctattatgtactgatatatgacacacgaaacttatgaaggggggaaattgaacccagaaagcttactgcgtacatacgcccaacggtgagaagcatcagctgccactcaccatttaaggtcaagctaaccatgtgctcagtaaaaatgggtaaatagcatttgttgtgtgggcattccactgtttgtaagctgacttgtaaaaacgtgtatctgagctaaactgagcacgaacagattcgatggacaatgttatctgctgtacatgcatgtagtaatgtagttttgatgactgtaattctctggtcgtcgcttccagttgcacggttgcaccgtatgttgcaaccaccaatagaactgaaagtaagtgagagtaatcaagccagcatctgctatgtatatatatgactcatcagtctgttatatatcacaaggaaagcttcttcaaagctaaaagcaaagctatcagtaagacagt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049003.1 RefSeq:Os01g0227100]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 1]]
| |
| − | [[Category:Chromosome 1]]
| |
Please input one-sentence summary here.
nyc1 is a recessive mutant in rice and it canretain green leaves during senescence.
Annotated Information
Function
Please input function information here.
The symbol of the gene “Os01g0227100” is NYC1.
nyc1 is a recessive mutant in rice, nyc1 was isolated as a stay-green mutant in the paddy field. nyc1 remains green until just before death in natural senescence and does not show yellowing.In nyc1, most light-harvesting complex II(LHCII )members are selectively retained during senescence, in contrast with the wild type. nyc1retains granal structure during senescence.
1.Inhibition of LHCP Degradation in nyc1.
In wild-type senescent leaves, the abundance of these protein complexes was reduced remarkably at 5 DDI;In nyc1, the abundances of chlorophyll abinding proteins, LHCP dimer (whose major component is LHCI), PSI reaction center complex, and CP43/47 were reduced to similar levels as in the wild type at 5 and 7 DDI, but the LHCP trimer and monomer were apparent even at 7 DDI.
2.Inhibition of Degradation of Pigments Strongly Bound to LHCP in nyc1.
By 8 DDI, the amounts of most photosynthetic pigments exceptb-carotene were significantly reduced in the wild type. In nyc1, the degradation of not only chlorophyllaand chlorophyllbbut also neoxanthin and lutein was apparently inhibited.
3. the degradation of chlorophyll b was severely inhibited and light-harvesting complex II was selectively retained during senescence, resulting in the retention of thylakoid grana even at a late stage of senescence.
4.The protein encoded by NYC1 is necessary for catalyzing the first step of chlorophyll b degradation. Analysis of the nyc1 mutant, which shows the stay-green phenotype, revealed that chlorophyll b degradation is required for the degradation of light-harvesting complex II and thylakoid grana in leaf senescence.
Expression
Please input expression information here.
nyc1 was located between cleaved-amplified polymorphic sequence (CAPS) markers P0443E07.24 and P0452F10.5. Five genes were predicted in this≈40-kb region. One of them seems to encode encodes a protein with 504 amino acids belonging to the SDR family.The amino acid sequence of NYC1 contains all important amino acid residues conserved in the classical SDR family, including a dinucleotide binding motif (TGXXXGXG) and a catalytic site (YXXXK). NYC1 has an Arg at key position 15 (180th amino acid) and another at key position 37 (202nd amino acid). Sequence analysis of the nyc1-1 allele revealed a single base pair change, a G-to-A substitution, at the first exon/first intron junction, which may prevent splicing of the first intron and result in the early termination of translation.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
Graduate School of Agricultural and Life Sciences, University of Tokyo.
Institute of Low-Temperature Science, Hokkaido University.
Institute of Radiation Breeding, National Institute of Agrobiological Sciences.
Chugoku National Agricultural Research Center for WesternRegion, National Agriculture and Bio-oriented Research Organization.
References
Please input cited references here.
[1] Yutaka Sato1,+, Ryouhei Morita2, Susumu Katsuma1, Minoru Nishimura2, Ayumi Tanaka3 and Makoto Kusaba1,4,*(2009)Rice NON-YELLOW COLORING1 Is Involved in Light-Harvesting Complex II and Grana Degradation during Leaf Senescence.The Plant Journal.57:121-130.
[2]Makoto Kusaba,a,1Hisashi Ito,b Ryouhei Morita,cShuichi Iida,dYutaka Sato,aMasaru Fujimoto,aShinji Kawasaki,eRyouichi Tanaka,bHirohiko Hirochika,eMinoru Nishimura,cand Ayumi Tanakab(2007)Two short-chain dehydrogenase/reductases, NON-YELLOW COLORING 1 and NYC1-LIKE, are required for chlorophyll b and light-harvesting complex II degradation during senescence in rice.The Plant Cell.19: 1362–1375.
Structured Information