Difference between revisions of "Os01g0286100"

From RiceWiki
Jump to: navigation, search
 
(41 intermediate revisions by 2 users not shown)
Line 1: Line 1:
  
The OsPIL15 gene is a member of the rice Phytochrome‐interacting factors (PIFs) family, in regulating seedling growth.
+
The ''OsPIL15'' gene (Os01g0286100), a phytochromeinteracting factor-like protein gene, is a member of the rice Phytochrome‐interacting factors (PIFs) family, in regulating seedling growth.[http://onlinelibrary.wiley.com/doi/10.1111/jipb.12137/full]
 +
 
 +
== Annotated Information ==
 +
 
 +
OsPIL15 encodes a basic helix-loop-helix factor localized in the nucleus.Basic helix-loop-helix (bHLH) proteins are the second largest class of plant transcription factors [http://onlinelibrary.wiley.com/doi/10.1111/j.1365-313X.2010.04459.x/abstract]. They comprise two distinct functional regions, a basic region and a helix-loop-helix. The former is required for DNA binding whereas the latter is needed for protein dimerization [http://mcb.asm.org/content/20/2/429.short]. Based on DNA-binding ability, the proteins are divided into two groups, 1) DNA-binding bHLH and 2) non-DNA-binding bHLH (HLH) also known as atypical bHLH.
  
==Annotated Information==
 
Basic helix-loop-helix (bHLH) proteins are the second largest class of plant transcription factors[http://onlinelibrary.wiley.com/doi/10.1111/j.1365-313X.2010.04459.x/full]. They comprise two distinct functional regions, a basic region and a helix-loop-helix. The former is required for DNA binding whereas the latter is needed for protein dimerization[http://mcb.asm.org/content/20/2/429.short]. Based on DNA-binding ability, the proteins are divided into two groups, 1) DNA-binding bHLH and 2) non-DNA-binding bHLH (HLH) also known as atypical bHLH[http://www.plantphysiology.org/content/141/4/1167.short].
 
 
===Function===
 
===Function===
Grain size is a major yield component in rice, and partly controlled by the sizes of the lemma and palea. Molecular mechanisms controlling the sizes of these organs largely remain unknown. In this study, we show that an antagonistic pair of basic helix-loop-helix (bHLH) proteins is involved in determining rice grain length by controlling cell length in the lemma/palea. Overexpression of an atypical bHLH, named POSITIVE REGULATOR OF GRAIN LENGTH 1 (PGL1), in lemma/palea increased grain length and weight in transgenic rice. PGL1 is an atypical non-DNA-binding bHLH and assumed to function as an inhibitor of a typical DNA-binding bHLH through heterodimerization. We identified the interaction partner of PGL1 and named it ANTAGONIST OF PGL1 (APG). PGL1 and APG interacted in vivo and localized in the nucleus. As expected, silencing of APG produced the same phenotype as overexpression of PGL1, suggesting antagonistic roles for the two genes. Transcription of two known grain-length-related genes, GS3 and SRS3, was largely unaffected in the PGL1-overexpressing and APG-silenced plants. Observation of the inner epidermal cells of lemma revealed that are caused by increased cell length. PGL1-APG represents a new grain length and weight-controlling pathway in which APG is a negative regulator whose function is inhibited by PGL1.[http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0031325#close]
+
Grain size is a major yield component in rice, and partly controlled by the sizes of the lemma and palea. Molecular mechanisms controlling the sizes of these organs largely remain unknown. In this study, we show that an antagonistic pair of basic helix-loop-helix (bHLH) proteins is involved in determining rice grain length by controlling cell length in the lemma/palea. Overexpression of an atypical bHLH, named POSITIVE REGULATOR OF GRAIN LENGTH 1 (PGL1), in lemma/palea increased grain length and weight in transgenic rice.Proteins with E-values of <4e−12 were selected for analysis; Os12g0610200, Os01g0286100, Os05g0139100, and Os04g0618600. Except for Os04g0618600, all candidates contained amino acids conserved in the basic domain required for binding to DNA. We found expression in the lemma/palea of these candidates. Thus, we chose these four candidates for analysis of interaction with PGL1.
 +
 
 +
OsPIL15‐OX seedlings exhibit an exaggerated shorter aboveground part and undeveloped root system relative to wild‐type seedlings, suggesting that OsPIL15 represses seedling growth in the dark. Microarray analysis combined with gene ontology analysis revealed that OsPIL15 represses a set of genes involved in auxin pathways and cell wall organization or biogenesis.Given the important roles of the auxin pathway and cell wall properties in controlling plant growth, we speculate that OsPIL15 represses seedling growth likely by regulating the auxin pathway and suppressing cell wall organization in etiolated rice seedlings. Additionally, exposure to red light or far‐red light relieved growth retardation and promoted seedling elongation in the OsPIL15‐OX lines, despite higher levels of OsPIL15 transcripts under red light and far‐red light than in the dark.These results suggest that light regulation of OsPIL15 expression is probably involved in photomorphogenesis in rice.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
To amplify cDNAs from a rice total RNA preparation, an RT-PCR kit was used according to instructions with specific primers. The resulting PCR fragments were cloned and sequenced with an automated DNA sequencer, with the recommended sequencing kits according to instructions[https://www.jstage.jst.go.jp/article/bbb/71/5/71_60643/_article]. The following primers were used for cDNA amplification:5'-ATGAATTCATGAACCAGTTCGTCCCTGATTGGAGC-3' and 5'-AAGAATTCTTATCCTGATCCTGTGTTGGGTGCATTTTCAGG-3'.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
An extensive inspection of the entire genome sequence databases of rice (Oryza sativa) revealed six candidate genes (or codingsequences)of PILs, which were esignated OsPIL11 to OsPIL16. A non-rooted neighbor-joining phylogenetic tree was constructed using the amino acid sequence of the bHLH DNA-binding domain.A PIL family is composed of seven members in A. thaliana and six members in O. sativa. (HFR1, GL3, ICE1, and RAP1 are not PIL family, and are used as an out-group.) For these rice OsPIL genes,the annotated ID-code for each coding sequence was adopted from the Rice Annotation Project, and the ID-codes are indicted in parentheses. For the Arabidopsis PIL family members, their characteristics are indicated in parentheses with regard to biological events in which they appear to be implicated: circadian rhythm, elongation of hypocotyls in red light,greening upon the onset of light exposure, shade avoidance, and germination.
 +
 
 +
==Labs working on this gene==
 +
[1]Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University,Chikusa-ku, Nagoya 464-8601, Japan
 +
 
 +
[2]Shandong Rice Research Institute, Shandong Academy of Agricultural Sciences, Jinan 250100, China
 +
 
 +
[3]Shandong Provincial Key Laboratory of Crop Genetic Improvement, Ecology and Physiology, Jinan 250100, China
  
You can also add sub-section(s) at will.
+
[4]Institute of Genetics and Developmental Biology, the Chinese Academy of Sciences, Beijing 100190, China
  
==Labs working on this gene==
+
[5]Graduate School of Horticulture, Chiba University, Chiba, Japan
Please input related labs here.
 
  
 
==References==
 
==References==
[http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0031325#close]Heang D, Sassa H. Antagonistic actions of HLH/bHLH proteins are involved in grain length and weight in rice[J]. PloS one, 2012, 7(2): e31325.
+
[1]Zhou J, Liu Q, Zhang F, et al. Overexpression of OsPIL15, a phytochrome‐interacting factor‐like protein gene, represses etiolated seedling growth in rice[J]. Journal of integrative plant biology, 2014.
 +
 
 +
[2]Feller A, Machemer K, Braun E L, et al. Evolutionary and comparative analysis of MYB and bHLH plant transcription factors[J]. The Plant Journal, 2011, 66(1): 94-116.
 +
 
 +
[3]Massari M E, Murre C. Helix-loop-helix proteins: regulators of transcription in eucaryotic organisms[J]. Molecular and cellular biology, 2000, 20(2): 429-440.
 +
 
 +
[4]Nakamura Y, Kato T, Yamashino T, et al. Characterization of a set of phytochrome-interacting factor-like bHLH proteins in Oryza sativa[J]. Bioscience, biotechnology, and biochemistry, 2007, 71(5): 1183-1191.
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0286100|
 
Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein|
 
Version = NM_001049310.1 GI:115436033 GeneID:4327916|
 
Length = 3148 bp|
 
Definition = Oryza sativa Japonica Group Os01g0286100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:10319113..10322260|
 
CDS = 10319429..10319542,10319639..10320124,10320218..10320283,10320371..10320436,10320598..10320690<br>,10320781..10321867,10321976..10321977|
 
GCID = <gbrowseImage1>
 
name=NC_008394:10319113..10322260
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:10319113..10322260
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtccgacggcaacgacttcgccgagctgctgtgggagaacggccaggcggtggtgcacgggaggaagaagcacccgcagccggccttcccgccgttcggcttcttcggtggcaccggcggtggcggcggcggcagcagtagtagagcccaggagaggcagcccggcggcatcgatgcgttcgccaaggtggggggcggcttcggcgccttgggcatggctccggcggtgcacgacttcgcttctggcttcggcgccaccacgcaggacaacggtgatgatgacaccgttccgtggatccattaccccataattgacgatgaagacgccgccgcccctgctgctctcgcagcagcggactatggctccgacttcttctccgagctccaggcggcggcggctgccgcggcggccgccgcgccgccgaccgatctcgcctctctgccagcctccaatcacaacggcgccaccaataacagaaatgctccggttgccaccaccaccaccagggaaccctccaaggaaagccacggcggcctgtcggttcccaccacccgagccgagccgcagccgcagccacagctcgccgcagccaagctgcctcggtcgagcggcagcggcggcggcgagggcgtgatgaacttctcgctcttctcccgcccggccgtcctggcgagggcgacgctggagagcgcgcagaggacgcagggcaccgacaataaggcgtccaatgtcaccgcgagcaaccgcgtcgagtcgacggtcgtgcagacggcgagcgggccaaggagcgcaccggcgttcgccgatcagagggcggcggcgtggccgccgcagccgaaggagatgccgttcgcgtccacggcagccgctcccatggccccggccgttaacctgcaccacgagatgggccgtgacagggcaggccgaaccatgcctgtccacaaaaccgaggcgaggaaggcacctgaggccacggtcgcgacatcgtcggtgtgctccggcaacggagctgggagtgacgagctgtggcgccagcagaagcggaagtgccaggcccaggcagagtgctcagctagccaagacgatgatcttgacgatgaacctggagtattgagaaaatctggaaccaggagcacgaaacgcagccgcacagctgaggttcacaatttatcagaaaggaggagaagggacaggatcaatgaaaagatgcgcgctctgcaagaactcattcccaactgcaacaagattgataaagcctcgatgctggatgaagctatagagtacctcaaaacccttcagcttcaagtacagatgatgtccatgggaactgggctgtgcattcctccaatgctattaccaacagccatgcagcacttgcaaattccaccgatggctcatttccctcatctcggcatgggattggggtacgggatgggcgtcttcgacatgagcaacactggagcacttcagatgccacccatgcctggtgctcactttccctgcccaatgatcccaggtgcgtcaccacaaggtcttgggatccctggcacaagcaccatgccaatgtttggggttcctgggcaaacaattccttcgtcagcgtctagtgtaccaccatttgcatctttggctggtcttcctgttaggccaagcggggtccctcaagtatcaggcgccatggctaacatggtgcaagaccagcaacaaggcatagcgaatcaacagcagcaatgtctgaacaaggaagctatacagggagcaaatccaggtgattcacaaatgcagatcatcatgcagggtgacaacgagaattttaggataccctcttcagcccaaacaaaaagcagtcaattttcagatggtaccggcaaggggaccaacgctagagagagagatggggctgaaacataa</cdnaseq>|
 
AA = <aaseq>MSDGNDFAELLWENGQAVVHGRKKHPQPAFPPFGFFGGTGGGGG                    GSSSRAQERQPGGIDAFAKVGGGFGALGMAPAVHDFASGFGATTQDNGDDDTVPWIHY                    PIIDDEDAAAPAALAAADYGSDFFSELQAAAAAAAAAAPPTDLASLPASNHNGATNNR                    NAPVATTTTREPSKESHGGLSVPTTRAEPQPQPQLAAAKLPRSSGSGGGEGVMNFSLF                    SRPAVLARATLESAQRTQGTDNKASNVTASNRVESTVVQTASGPRSAPAFADQRAAAW                    PPQPKEMPFASTAAAPMAPAVNLHHEMGRDRAGRTMPVHKTEARKAPEATVATSSVCS                    GNGAGSDELWRQQKRKCQAQAECSASQDDDLDDEPGVLRKSGTRSTKRSRTAEVHNLS                    ERRRRDRINEKMRALQELIPNCNKIDKASMLDEAIEYLKTLQLQVQMMSMGTGLCIPP                    MLLPTAMQHLQIPPMAHFPHLGMGLGYGMGVFDMSNTGALQMPPMPGAHFPCPMIPGA                    SPQGLGIPGTSTMPMFGVPGQTIPSSASSVPPFASLAGLPVRPSGVPQVSGAMANMVQ                    DQQQGIANQQQQCLNKEAIQGANPGDSQMQIIMQGDNENFRIPSSAQTKSSQFSDGTG                    KGTNARERDGAET</aaseq>|
 
DNA = <dnaseqindica>2719..2832#2137..2622#1978..2043#1825..1890#1571..1663#394..1480#284..285#aggtccccccacgccacagcctcttatcccacacgcggaccaacagcgccgccccgcccgtcccccgcttcaccttcggcttcgacttcggcttcgtttcctcttctcttcgtctctccctccctccagcgaaagaaagagagagctcacctcgcgttgcccggccggccgcggaggagagcacggcttcgcattcggctggagctctcgtctctgcactcggagtacagctgcaaactcctccttccttgatttcttcaccctgtctccacggactgcacagatgtgggtgcaacgcgatctttcgctgcctccggtttagctctccggttgattccgatcgaggaagctgatgcatgtgtttgtatatggctcggtgttttgtgtgtgcaggtccgacggcaacgacttcgccgagctgctgtgggagaacggccaggcggtggtgcacgggaggaagaagcacccgcagccggccttcccgccgttcggcttcttcggtggcaccggcggtggcggcggcggcagcagtagtagagcccaggagaggcagcccggcggcatcgatgcgttcgccaaggtggggggcggcttcggcgccttgggcatggctccggcggtgcacgacttcgcttctggcttcggcgccaccacgcaggacaacggtgatgatgacaccgttccgtggatccattaccccataattgacgatgaagacgccgccgcccctgctgctctcgcagcagcggactatggctccgacttcttctccgagctccaggcggcggcggctgccgcggcggccgccgcgccgccgaccgatctcgcctctctgccagcctccaatcacaacggcgccaccaataacagaaatgctccggttgccaccaccaccaccagggaaccctccaaggaaagccacggcggcctgtcggttcccaccacccgagccgagccgcagccgcagccacagctcgccgcagccaagctgcctcggtcgagcggcagcggcggcggcgagggcgtgatgaacttctcgctcttctcccgcccggccgtcctggcgagggcgacgctggagagcgcgcagaggacgcagggcaccgacaataaggcgtccaatgtcaccgcgagcaaccgcgtcgagtcgacggtcgtgcagacggcgagcgggccaaggagcgcaccggcgttcgccgatcagagggcggcggcgtggccgccgcagccgaaggagatgccgttcgcgtccacggcagccgctcccatggccccggccgttaacctgcaccacgagatgggccgtgacagggcaggccgaaccatgcctgtccacaaaaccgaggcgaggaaggcacctgaggccacggtcgcgacatcgtcggtgtgctccggcaacggagctgggagtgacgagctgtggcgccagcagaagcggaagtgccaggcccaggcagagtgctcagctagccaagacgatgtaagtaaatggtatgagatagatatgcactgcataaccagctgactataccttcgctgattctcatgataaaaaactggttctattcaggatcttgacgatgaacctggagtattgagaaaatctggaaccaggagcacgaaacgcagccgcacagctgaggttcacaatttatcagaaagggtgagtagctcacatcttcagtgcatggatcatcctgcatccatttgcttcaaagttcacatgtcagtgcattgatcatcctgcatccatttgcttcaatcccatgactcgactcatgctgcaattttattgactgtattgcaacccaacaatctttgcagaggagaagggacaggatcaatgaaaagatgcgcgctctgcaagaactcattcccaactgcaacaaggtaaagataagccattccatcgtcttgctccctctgagatgcctctgaatgaacatttggtcaattcaggcatgctatgttttgcagattgataaagcctcgatgctggatgaagctatagagtacctcaaaacccttcagcttcaagtacaggtacattgaaactgccttcgaacaaatgtaccatgattgtcgggtgaatatgtacatagatgcattgacaaggtgcagttgtcattgacacagatgatgtccatgggaactgggctgtgcattcctccaatgctattaccaacagccatgcagcacttgcaaattccaccgatggctcatttccctcatctcggcatgggattggggtacgggatgggcgtcttcgacatgagcaacactggagcacttcagatgccacccatgcctggtgctcactttccctgcccaatgatcccaggtgcgtcaccacaaggtcttgggatccctggcacaagcaccatgccaatgtttggggttcctgggcaaacaattccttcgtcagcgtctagtgtaccaccatttgcatctttggctggtcttcctgttaggccaagcggggtccctcaagtatcaggcgccatggctaacatggtgcaagaccagcaacaaggcatagcgaatcaacagcagcaatgtctgaacaaggaagctatacagggagcaaatccaggtgattcacaaatgcagatcatcatgcaggtactaattaaaaattaacaaatgatgtcaagcgaatagaagacatttgctagtacttaagtgcattacttactccagtttattttaatattccagggtgacaacgagaattttaggataccctcttcagcccaaacaaaaagcagtcaattttcagatggtaccggcaaggggaccaacgctagagagagagatggggctgaaacataaagaaaggccagtaggtgtaacttgactttcatgctaaatttgagatctaccactgaaatctgcagaatgttcctgtcctaaaaagatcaatggctgaggaatttcatgtacgaccaactaacaacttccagatatgaaagttagcaattcatactgggagaacttacttgagtatcaagatccacgaggcagatgtatcagccaagatgccccaaaattttgtgtaaaatgtagatggtagaagatgctaccaggttacaagctgtaattcttgacttccagtgcagtttcctatgagtagtttttgccctatctg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049310.1 RefSeq:Os01g0286100]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 04:40, 14 May 2015

The OsPIL15 gene (Os01g0286100), a phytochromeinteracting factor-like protein gene, is a member of the rice Phytochrome‐interacting factors (PIFs) family, in regulating seedling growth.[1]

Annotated Information

OsPIL15 encodes a basic helix-loop-helix factor localized in the nucleus.Basic helix-loop-helix (bHLH) proteins are the second largest class of plant transcription factors [2]. They comprise two distinct functional regions, a basic region and a helix-loop-helix. The former is required for DNA binding whereas the latter is needed for protein dimerization [3]. Based on DNA-binding ability, the proteins are divided into two groups, 1) DNA-binding bHLH and 2) non-DNA-binding bHLH (HLH) also known as atypical bHLH.

Function

Grain size is a major yield component in rice, and partly controlled by the sizes of the lemma and palea. Molecular mechanisms controlling the sizes of these organs largely remain unknown. In this study, we show that an antagonistic pair of basic helix-loop-helix (bHLH) proteins is involved in determining rice grain length by controlling cell length in the lemma/palea. Overexpression of an atypical bHLH, named POSITIVE REGULATOR OF GRAIN LENGTH 1 (PGL1), in lemma/palea increased grain length and weight in transgenic rice.Proteins with E-values of <4e−12 were selected for analysis; Os12g0610200, Os01g0286100, Os05g0139100, and Os04g0618600. Except for Os04g0618600, all candidates contained amino acids conserved in the basic domain required for binding to DNA. We found expression in the lemma/palea of these candidates. Thus, we chose these four candidates for analysis of interaction with PGL1.

OsPIL15‐OX seedlings exhibit an exaggerated shorter aboveground part and undeveloped root system relative to wild‐type seedlings, suggesting that OsPIL15 represses seedling growth in the dark. Microarray analysis combined with gene ontology analysis revealed that OsPIL15 represses a set of genes involved in auxin pathways and cell wall organization or biogenesis.Given the important roles of the auxin pathway and cell wall properties in controlling plant growth, we speculate that OsPIL15 represses seedling growth likely by regulating the auxin pathway and suppressing cell wall organization in etiolated rice seedlings. Additionally, exposure to red light or far‐red light relieved growth retardation and promoted seedling elongation in the OsPIL15‐OX lines, despite higher levels of OsPIL15 transcripts under red light and far‐red light than in the dark.These results suggest that light regulation of OsPIL15 expression is probably involved in photomorphogenesis in rice.

Expression

To amplify cDNAs from a rice total RNA preparation, an RT-PCR kit was used according to instructions with specific primers. The resulting PCR fragments were cloned and sequenced with an automated DNA sequencer, with the recommended sequencing kits according to instructions[4]. The following primers were used for cDNA amplification:5'-ATGAATTCATGAACCAGTTCGTCCCTGATTGGAGC-3' and 5'-AAGAATTCTTATCCTGATCCTGTGTTGGGTGCATTTTCAGG-3'.

Evolution

An extensive inspection of the entire genome sequence databases of rice (Oryza sativa) revealed six candidate genes (or codingsequences)of PILs, which were esignated OsPIL11 to OsPIL16. A non-rooted neighbor-joining phylogenetic tree was constructed using the amino acid sequence of the bHLH DNA-binding domain.A PIL family is composed of seven members in A. thaliana and six members in O. sativa. (HFR1, GL3, ICE1, and RAP1 are not PIL family, and are used as an out-group.) For these rice OsPIL genes,the annotated ID-code for each coding sequence was adopted from the Rice Annotation Project, and the ID-codes are indicted in parentheses. For the Arabidopsis PIL family members, their characteristics are indicated in parentheses with regard to biological events in which they appear to be implicated: circadian rhythm, elongation of hypocotyls in red light,greening upon the onset of light exposure, shade avoidance, and germination.

Labs working on this gene

[1]Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University,Chikusa-ku, Nagoya 464-8601, Japan

[2]Shandong Rice Research Institute, Shandong Academy of Agricultural Sciences, Jinan 250100, China

[3]Shandong Provincial Key Laboratory of Crop Genetic Improvement, Ecology and Physiology, Jinan 250100, China

[4]Institute of Genetics and Developmental Biology, the Chinese Academy of Sciences, Beijing 100190, China

[5]Graduate School of Horticulture, Chiba University, Chiba, Japan

References

[1]Zhou J, Liu Q, Zhang F, et al. Overexpression of OsPIL15, a phytochrome‐interacting factor‐like protein gene, represses etiolated seedling growth in rice[J]. Journal of integrative plant biology, 2014.

[2]Feller A, Machemer K, Braun E L, et al. Evolutionary and comparative analysis of MYB and bHLH plant transcription factors[J]. The Plant Journal, 2011, 66(1): 94-116.

[3]Massari M E, Murre C. Helix-loop-helix proteins: regulators of transcription in eucaryotic organisms[J]. Molecular and cellular biology, 2000, 20(2): 429-440.

[4]Nakamura Y, Kato T, Yamashino T, et al. Characterization of a set of phytochrome-interacting factor-like bHLH proteins in Oryza sativa[J]. Bioscience, biotechnology, and biochemistry, 2007, 71(5): 1183-1191.

Structured Information