|
|
| (9 intermediate revisions by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | ''Ospdr9'', encodes apleiotropic drug resistance (PDR)-type ATP-binding (ABC) protein in plant responses to environmental stresses <ref name="ref2" />. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | |
| | ===Function=== | | ===Function=== |
| − | ''Ospdr9'' gene locates in chromosome 1 with 21 exons and 20 introns <ref name="ref1" />. It is consist of an open reading frame (4371 bp) and a 3’untranslated region (313 bp), including a poly-A tail of 18bp. It encodes a pleiotropic drug resistance (PDR)-type ATP-binding (ABC) protein <ref name="ref2" />. There are 15 members in PDR protein subfamily in rice <ref name="ref3" />, and OsPDR9 protein of 1457 amino acids is predicted to be 163 kDa with a calculated pI of 6.7. Two hydrophilic ABC domains with the length of 150 amino acids compose the full-size ABC transporter protein OsPDR9, and both of the two domains have a well-conserved Walker A motif and less conserved Walker B and ABC signature sequences <ref name="ref4" />. According to TMHMM2.0 program, OsPDR9 is predicted to have two hydrophobic integral membrane domains, each with six potential transmembrane-spanning α-helices (TMS). | + | ''Ospdr9'' gene locates in chromosome 1 with 21 exons and 20 introns <ref name="ref1" />. It is consist of an open reading frame (4371 bp) and a 3’untranslated region (313 bp), including a poly-A tail of 18bp. It encodes a pleiotropic drug resistance (PDR)-type ATP-binding (ABC) protein <ref name="ref2" />. There are 23 members in PDR protein subfamily in rice <ref name="ref3" />, and OsPDR9 protein of 1457 amino acids is predicted to be 163 kDa with a calculated pI of 6.7. Two hydrophilic ABC domains with the length of 150 amino acids compose the full-size ABC transporter protein OsPDR9, and both of the two domains have a well-conserved Walker A motif and less conserved Walker B and ABC signature sequences <ref name="ref4" />. According to TMHMM2.0 program, OsPDR9 is predicted to have two hydrophobic integral membrane domains, each with six potential transmembrane-spanning α-helices (TMS). |
| | | | |
| | ===Expression=== | | ===Expression=== |
| | + | [[File:OsPDR91.jpg|right|thumb|430px|'''Figure 2.''' Early ''ospdr9'' expression in rice roots in response to various stresses. RT-PCR products of ''ospdr9'' and ''rac1'' (upper panels) and ''adh1'' and ''rac1'' (lower panels) were separated on 1.1% agarose gels and stained with ethidium bromide.3RT lanes show typical 3RT reactions in which reverse transcriptase was omitted. gDNA lanes show PCR amplifications on genomic DNA with each primer pair in the same conditions. Sizes of cDNA (left) or gDNA products (right) are indicated. A: RNA was prepared from the roots of rice seedlings that were incubated on growth medium (controls C1,C2 and C3), incubated on growth medium supplemented with PEG (15 or 13.5%), kept in the cold (4oC, CO), exposed to heat (42oC, H), or incubated on growth medium supplemented with ZnSO4 (5 or 2.5 mM) for 2 h. B: Rice seedlings were incubated on growth medium (controls C4 and C5) or on growth medium supplemented with KCl (5 mM), MgSO4 (2.5 mM), CoCl2 (250 WM and 2.5 mM), NiCl2 (250 WM and 2.5 mM), or ethanol (0.5% and 5%) for 2 h. Equal amounts of rac1 were detected, except during ethanol toxicity (5%) which caused a decline of the rac1 messenger(from reference<ref name="ref2" />).]] |
| | When there is not stress, ''ospdr9'' is not constitutively expressed in roots as well as in the shoot of rice seedlings. However, a significant amount of ospdr9 transcription can be detected in rice roots by RT-PCR expression analysis after exposing to PEG (13.5 and 15%) within 2 h <ref name="ref2" />. But a 2 h exposure to low or high temperatures (4oC and 42oC) does not induce the expression of ''Ospdr9'' (Fig. 2A). Toxic chemicals, for example, ZnSO4 (2.5 or 5 mM), cobalt and nickel chloride (250 WM and 2.5 mM), markedly induce ospdr9 in rice roots (Fig. 2B); Co generally causes a stronger ''ospdr9'' expression than Ni. Low oxygen stress is a stronger inducer of ''ospdr9'' than salt shock in rice roots, for the expression of ''ospdr9'' induced by salt stress is not only being delayed but also at low levels. It was also suggested that toxic and hypoxic PEG effects were more important than osmotic PEG effects in generating the marked PEG response of ospdr9 <ref name="ref2" />. | | When there is not stress, ''ospdr9'' is not constitutively expressed in roots as well as in the shoot of rice seedlings. However, a significant amount of ospdr9 transcription can be detected in rice roots by RT-PCR expression analysis after exposing to PEG (13.5 and 15%) within 2 h <ref name="ref2" />. But a 2 h exposure to low or high temperatures (4oC and 42oC) does not induce the expression of ''Ospdr9'' (Fig. 2A). Toxic chemicals, for example, ZnSO4 (2.5 or 5 mM), cobalt and nickel chloride (250 WM and 2.5 mM), markedly induce ospdr9 in rice roots (Fig. 2B); Co generally causes a stronger ''ospdr9'' expression than Ni. Low oxygen stress is a stronger inducer of ''ospdr9'' than salt shock in rice roots, for the expression of ''ospdr9'' induced by salt stress is not only being delayed but also at low levels. It was also suggested that toxic and hypoxic PEG effects were more important than osmotic PEG effects in generating the marked PEG response of ospdr9 <ref name="ref2" />. |
| | In addition, micromolar heavy metals cadmium and zinc concentrations markedly induce ''ospdr9'' in rice roots specifically and rapidly, which may due to the similar mechanism of root-to-shoot metal transport barriers, as observed in Arabidopsis <ref name="ref5" />. DTT (Fig. 6) is stronger inducer of ''ospdr9'' than hydrogen peroxide in rice roots, which suggested a response to redox perturbations that favour the reduced state <ref name="ref2" />. Moreover, the non-thiol antioxidant ascorbic acid also induced ''ospdr9'' in rice roots (Fig. 6). The strong oxidant hydrogen peroxide also induced ospdr9 expression, though at three times lower levels than DTT (Fig. 6), which indicated a response to oxidative conditions as well<ref name="ref2" />. | | In addition, micromolar heavy metals cadmium and zinc concentrations markedly induce ''ospdr9'' in rice roots specifically and rapidly, which may due to the similar mechanism of root-to-shoot metal transport barriers, as observed in Arabidopsis <ref name="ref5" />. DTT (Fig. 6) is stronger inducer of ''ospdr9'' than hydrogen peroxide in rice roots, which suggested a response to redox perturbations that favour the reduced state <ref name="ref2" />. Moreover, the non-thiol antioxidant ascorbic acid also induced ''ospdr9'' in rice roots (Fig. 6). The strong oxidant hydrogen peroxide also induced ospdr9 expression, though at three times lower levels than DTT (Fig. 6), which indicated a response to oxidative conditions as well<ref name="ref2" />. |
| | + | [[File:OsPDR92.jpg|right|thumb|250px|'''Figure 6.''' ''Ospdr9'' expression in rice roots in response to DTT, hydrogen peroxide and ascorbic acid. RT-PCR expression patterns of ''ospdr9'' and ''rac1''. Rice seedlings were incubated on growth medium (controls C12 and C13) or on growth medium supplemented with 5 mM DTT or 5 mM H2O2 for 1, 2, 3, 4 and 6 h or on 5 mM ascorbic acid (ASC) for 3 and 4 h. Equal amounts of rac1 were detected in all lanes. (from reference<ref name="ref2" />).]] |
| | + | Jasmonates induced more than half of the PDR genes expresses in roots of rice, and among them ''ospdr9'' is the highest level. Data from method of expressed sequence tag indicated that ''ospdr9'' was expressed at high levels in callus under various treatments, including ABA, and this probably reflected the stress and phytohormonal response of the gene that observed in roots<ref name="ref6" />. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| Line 25: |
Line 29: |
| | <ref name="ref4">Bairoch, A. PROSITE: a dictionary of sites and patterns in proteins (1992). Nucleic Acids Res. 20 (Suppl.), 2013-2018.</ref> | | <ref name="ref4">Bairoch, A. PROSITE: a dictionary of sites and patterns in proteins (1992). Nucleic Acids Res. 20 (Suppl.), 2013-2018.</ref> |
| | <ref name="ref5">Bovet, L., Eggmann, T., Meylan-Bettex, M., Polier, J., Kammer, P., Marin, E., Feller, U. and Martinoia, E. Transcript levels of AtMRPs after cadmium treatment: induction of AtMRP3. (2003) Plant. Cell Environ. 26, 371-381.</ref> | | <ref name="ref5">Bovet, L., Eggmann, T., Meylan-Bettex, M., Polier, J., Kammer, P., Marin, E., Feller, U. and Martinoia, E. Transcript levels of AtMRPs after cadmium treatment: induction of AtMRP3. (2003) Plant. Cell Environ. 26, 371-381.</ref> |
| | + | <ref name="ref6">Moons A .Transcriptional profiling of thePDRgene family in rice roots in response to plant growth regulators, redox perturbations and weak organic acid stresses. (2008). Planta. 229:53–71.</ref> |
| | </references> | | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]] |
| − | GeneName = Os01g0609300|
| |
| − | Description = PDR-like ABC transporter (PDR3 ABC transporter)|
| |
| − | Version = NM_001050074.1 GI:115438435 GeneID:4327728|
| |
| − | Length = 6852 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0609300, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:25732000..25738851|
| |
| − | CDS = 25732258..25732515,25732608..25732862,25732944..25733115,25733193..25733420,25733520..25733653<br>,25733740..25733823,25733966..25734256,25734334..25734666,25734751..25735001<br>,25735089..25735355,25735442..25735602,25735713..25736029,25736121..25736402<br>,25736488..25736789,25736882..25736972,25737061..25737114,25737232..25737308<br>,25737435..25737594,25737864..25737948,25738156..25738365,25738471..25738832<br>|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:25732000..25738851
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:25732000..25738851
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggacgcggcgggggagatccagaaggtggcgagcatgcggctaggggggagcatgaggggggacagcgggtcgatgtggaggagaggggacgacgtgttctcgaggtcgtcgagggaggaggacgacgaggaggcgctgcggtgggcggcgctcgagaagctgcccacctacgaccgcgtgcgccgcgccatcctgccgctcggtggcgacgacggcgccggggacggaggagggaagggcgtcgtggacgtgcacgggctcggcccgcgcgagcgccgcgcgctcctcgagcgcctcgtgcgcgtcgccgacgaggacaacgagaagttcctcctcaagctcaaggaccgcgtcgaccgggtggggatcgacatgccgacgatcgaggtgcggttcgagcacctggaggcggaggcggaggtccgcgtcggcaacagcggcctccccaccgtcctcaactccatcaccaacaccctcgaggaagccggcaacgcgctcggcattctgcccaaccggaagcagaccatgcccgtcctccacgacgtcagcggcatcatcaagccccgcaggatgactctgctgttaggcccaccggggtcaggcaagaccaccttgctgctcgcgttggccggaaggctcggcaaagatctcaaggcttcaggaaaagtgacctacaacgggcacggcatggaggaattcgtgccggagaggacggcggcttacatcagccagcacgacctccacatcggagagatgaccgtcagggagacacttgccttctcggcacgatgccagggtgttggcagtcgctttgatatgttgactgagctgtcaaggcgagagaaggcagcgaacattaagcctgacgccgatatcgatgcattcatgaaggcggctgcaatgggaggacaggaggcaaacgtgaacactgactatatactgaagatattaggactagagatatgcgctgacacgatggttggggacgagatgctgaggggcatctcaggtgggcaaagaaagcgtgttacgactggtgagatgctggttgggccagccagggcgctcttcatggacgagatctcaactgggcttgacagctccactacattccagatagtgaattcgcttaggcaaactgtccacatcctcggtggcacagctgttatctccctgctgcagccggcgcctgagacttacaacttgtttgatgatatcatcctcctctcagacggtcagattgtgtaccagggcccccgagaggatgtgcttgaattcttcgagtccatggggtttaagtgtcctgacaggaagggtgttgccgacttcttgcaagaagtgacttctaagaaagatcaaaggcagtactgggcgaggcatgacaagccctacaggtttgtgacggttaaggaatttgtgagtgcattccagtcgttccacacagggagagctatagcaaacgaacttgctgttccgtttgataagagtaagagccatcctgccgcactggctaccacaaggtacggtgctcctggcaaggagctgctgaaggcaaatattgacagggagattctcctcatgaagaggaactctttcgtctacatgttcagaaccttccagttgatggtggtgtcactcattgcaatgacactcttcttccgtacgaaaatgaaacgtgattctgtgaccagcgggggcatctacatgggcgcactcttctttggtgtgcttatgatcatgttcaatggtttctcagagcttgcgctcactgtctttaagttgcctgttttcttcaagcagagggatctccttttttatcctgcatggtcgtacactataccctcatggattctcaagatcccaatcacgtttattgaggttggtgggtatgtgttcttaacatactacgtcattgggtttgactcaaacgtgggcagcttcttcaagcagtatttgctcatgttagcaatcaatcagatggcgggatcacttttccgattcattggtggggcagcgaggaacatgattgttgcaaatgtctttgcatcattcatgctgctaatttttatggtattgggtggattcattctagcaagagagcaagtgaagaaatggtggatttggggctactggatatccccgatgatgtacgcccagaatgccatctcagttaatgaactcatggggcacagctggaacaaaattgtgaatagctctgcctccaatgagacccttggtgtgcaagtcctcaagtcccgtggagtattccctgaagccaggtggtattggattgggtttggtgcaatgatcggcttcaccatccttttcaatgctctcttcacccttgcccttacatacctcaggccatatggaaattcccgtcagtcagtatcagaagaggaactgaaagagaagcgtgccaatctgaatggtgagattgtgggtgacgttcacttgtcatctggaagtacgcgtaggccaatgggaaacggcactgaaaatgattcaacaattgttgatgatgatactgaggttactcaaagggggatggttctcccatttactccgctttcactcagctttgacaatgtcagatattctgttgacatgccacaggaaatgaaagcacaaggtgtagctgatgaccggttggagctcctcaaaggtgttagtggttcattcaggccaggggtgttgactgcactaatgggtgtcagtggtgctggcaagacaacactgatggatgtattggctgggagaaagacaggtgggtacattgaaggaagcatcaacatttcaggatatccaaagaaacaagagacttttgcacgtgtgtctggatactgtgagcagaacgatatccactcaccgcaggtcacagtctatgagtcgctacttttctcagcatggctccgtcttcctgaggatgtagattccaacactagaaagatgttcattgaggaggtgatggagcttgtggagctcaagtcactgagagatgctttggttgggcttcctggagtgaatggtctgtccactgaacaaagaaagaggctaacaatcgcagtggagcttgttgcaaacccttcgattatattcatggacgagccaacctcagggcttgatgcacgagcagctgcaattgtgatgaggacagtgaggaacactgttaatactggcagaactgtggtgtgcacaattcatcagcctagcattgacatatttgaagcatttgatgagcttttcctgatgaagcgaggtggtgaagagatctatgctggtccactaggccatcattcttcggagctgatcaagtattttgagagtatcccaggggtcagcaaaatcaaagatggctataacccagcaacatggatgttggaggtgacaacaattggtcaagagcaggcacttggtgttgattttagtgatatatacaagaagtctgaactttaccagaggaacaaggccttgataaaggacctgagccaaccagcccccgattcaagtgacctgtatttccctacccaatattctcagtcttctttaacacaatgcatggcttgcctgtggaagcaaaacctgtcatactggaggaaccctccttacaatgccgttaggttctttttcactactgtcattgctcttctctttggtaccatcttctgggaccttggcggcaaagtgacgaagtcacaagacttgttcaatgccatggggtcaatgtatgcagcagtgctgttcatcggtgtcatgaactgtacatctgttcagccagtggtggccgtggagcggacagtcttttaccgtgaaagggctgccggcatgtactcggcgtttccatatgcatttggccaggttgtcattgagatcccatacacactggttcaggctactgtatacgggatcatagtgtatgcgatgattgggttcgagtggacggctgccaagttcttctggtacctcttcttcatggtcttcacgctcctctacttcacattctacggcatgatggcggtcggcctgacaccgaactaccacattgcctcgatcgtctcatcggcgttctacgccatctggaatctcttctccggcttcgtcatcccccgacctagagtcccaatctggtggagatggtattgctgggcgtgccccgtcgcgtggacgctgtacggcctcgtcgtctcccagttcggtgacatcgagacgccgatggaagacggcacccctgtgaaggtgtttgtggagaactacttcggcttcaagcacagctggttgggctgggtggccaccgtggtcgctgccttcgctttcctcttcgcttccttgtttggcttcgctatcatgaagttcaacttccagaagagatga</cdnaseq>|
| |
| − | AA = <aaseq>MDAAGEIQKVASMRLGGSMRGDSGSMWRRGDDVFSRSSREEDDE EALRWAALEKLPTYDRVRRAILPLGGDDGAGDGGGKGVVDVHGLGPRERRALLERLVR VADEDNEKFLLKLKDRVDRVGIDMPTIEVRFEHLEAEAEVRVGNSGLPTVLNSITNTL EEAGNALGILPNRKQTMPVLHDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGRLGKDL KASGKVTYNGHGMEEFVPERTAAYISQHDLHIGEMTVRETLAFSARCQGVGSRFDMLT ELSRREKAANIKPDADIDAFMKAAAMGGQEANVNTDYILKILGLEICADTMVGDEMLR GISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQTVHILGGTAVIS LLQPAPETYNLFDDIILLSDGQIVYQGPREDVLEFFESMGFKCPDRKGVADFLQEVTS KKDQRQYWARHDKPYRFVTVKEFVSAFQSFHTGRAIANELAVPFDKSKSHPAALATTR YGAPGKELLKANIDREILLMKRNSFVYMFRTFQLMVVSLIAMTLFFRTKMKRDSVTSG GIYMGALFFGVLMIMFNGFSELALTVFKLPVFFKQRDLLFYPAWSYTIPSWILKIPIT FIEVGGYVFLTYYVIGFDSNVGSFFKQYLLMLAINQMAGSLFRFIGGAARNMIVANVF ASFMLLIFMVLGGFILAREQVKKWWIWGYWISPMMYAQNAISVNELMGHSWNKIVNSS ASNETLGVQVLKSRGVFPEARWYWIGFGAMIGFTILFNALFTLALTYLRPYGNSRQSV SEEELKEKRANLNGEIVGDVHLSSGSTRRPMGNGTENDSTIVDDDTEVTQRGMVLPFT PLSLSFDNVRYSVDMPQEMKAQGVADDRLELLKGVSGSFRPGVLTALMGVSGAGKTTL MDVLAGRKTGGYIEGSINISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWL RLPEDVDSNTRKMFIEEVMELVELKSLRDALVGLPGVNGLSTEQRKRLTIAVELVANP SIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFEAFDELFLMKRG GEEIYAGPLGHHSSELIKYFESIPGVSKIKDGYNPATWMLEVTTIGQEQALGVDFSDI YKKSELYQRNKALIKDLSQPAPDSSDLYFPTQYSQSSLTQCMACLWKQNLSYWRNPPY NAVRFFFTTVIALLFGTIFWDLGGKVTKSQDLFNAMGSMYAAVLFIGVMNCTSVQPVV AVERTVFYRERAAGMYSAFPYAFGQVVIEIPYTLVQATVYGIIVYAMIGFEWTAAKFF WYLFFMVFTLLYFTFYGMMAVGLTPNYHIASIVSSAFYAIWNLFSGFVIPRPRVPIWW RWYCWACPVAWTLYGLVVSQFGDIETPMEDGTPVKVFVENYFGFKHSWLGWVATVVAA FAFLFASLFGFAIMKFNFQKR</aaseq>|
| |
| − | DNA = <dnaseqindica>6337..6594#5990..6244#5737..5908#5432..5659#5199..5332#5029..5112#4596..4886#4186..4518#3851..4101#3497..3763#3250..3410#2823..3139#2450..2731#2063..2364#1880..1970#1738..1791#1544..1620#1258..1417#904..988#487..696#20..381#gttttggtggtggtgggagatggacgcggcgggggagatccagaaggtggcgagcatgcggctaggggggagcatgaggggggacagcgggtcgatgtggaggagaggggacgacgtgttctcgaggtcgtcgagggaggaggacgacgaggaggcgctgcggtgggcggcgctcgagaagctgcccacctacgaccgcgtgcgccgcgccatcctgccgctcggtggcgacgacggcgccggggacggaggagggaagggcgtcgtggacgtgcacgggctcggcccgcgcgagcgccgcgcgctcctcgagcgcctcgtgcgcgtcgccgacgaggacaacgagaagttcctcctcaagctcaaggaccgcgtcgaccggtgcgtgcgttgccgccagttctcgtcttcgcatggccgcgtttctctgctttgcgcccgctaggtgtttgatctaacgactttcgcgcttgcgctgtgcgacagggtggggatcgacatgccgacgatcgaggtgcggttcgagcacctggaggcggaggcggaggtccgcgtcggcaacagcggcctccccaccgtcctcaactccatcaccaacaccctcgaggaagccggcaacgcgctcggcattctgcccaaccggaagcagaccatgcccgtcctccacgacgtcagcggcatcatcaagccccgcaggtgaaacaccatcccccccccccccccaacacactcccacacccacatgttgttttcaccaaaaaaaaaaagaacatggattctcttgtcttctggagcaatttttatctctcgtgttggagactggattagttaaatccgggtctttttttttagaattcaatttcttcgccttcttcccacctcacgttcttttcgtttctacaggatgactctgctgttaggcccaccggggtcaggcaagaccaccttgctgctcgcgttggccggaaggctcggcaaagatctcaaggttcgttcatccaaaaccaacttcttgcaaataattcaattccagatgcctgtatcccactataggcgcagtgtttcagcttctcatctctactagtagtactgctccagtacgtactaatacgaagaatgagttagccaaagaagaaaacacagagtagtacggggagttctttatttgggaaaaagaaaataagagatggatactggagtacgaattatactgggcgttcacacgttgttgatgagtataacgagatgcaattgcaggcttcaggaaaagtgacctacaacgggcacggcatggaggaattcgtgccggagaggacggcggcttacatcagccagcacgacctccacatcggagagatgaccgtcagggagacacttgccttctcggcacgatgccagggtgttggcagtcgctttggtaaattctacacgattctcagcagtagtagttgccttttttactgcttgcggattatgcgggattgcatggttggacgggcatgctaaaccaagttttcctttttcctgttgttttttttttcagatatgttgactgagctgtcaaggcgagagaaggcagcgaacattaagcctgacgccgatatcgatgcattcatgaaggtaaaaggatttacgaatccgaaataaaatcaacaagattttggtgtcctcttacttttgttaatttttctttttgaaacgaggactaagcattggttttctggtcaacttgttcaggcggctgcaatgggaggacaggaggcaaacgtgaacactgactatatactgaaggtgcatccatctttgagctagtgattaaattttaggtagaattacccaagaatttcttgttcaatgcattggacgttacttgttgcagatattaggactagagatatgcgctgacacgatggttggggacgagatgctgaggggcatctcaggtgggcaaagaaagcgtgttacgactggtgaggattgaactccaacacaaattcagattgagactaacggctatgaatgaaccacggtgtgattattcctattttgatgcgttctgtaggtgagatgctggttgggccagccagggcgctcttcatggacgagatctcaactgggcttgacagctccactacattccagatagtgaattcgcttaggcaaactgtccacatcctcggtggcacagctgttatctccctgctgcagccggcgcctgagacttacaacttgtttgatgatatcatcctcctctcagacggtcagattgtgtaccagggcccccgagaggatgtgcttgaattcttcgagtccatggggtttaagtgtcctgacaggaagggtgttgccgacttcttgcaagaagtatgttcatatctcactgttcttttttctatgaacacataaagtacagtttttgataatatatgtctgtgcaaatgccgagcaggtgacttctaagaaagatcaaaggcagtactgggcgaggcatgacaagccctacaggtttgtgacggttaaggaatttgtgagtgcattccagtcgttccacacagggagagctatagcaaacgaacttgctgttccgtttgataagagtaagagccatcctgccgcactggctaccacaaggtacggtgctcctggcaaggagctgctgaaggcaaatattgacagggagattctcctcatgaagaggaactctttcgtctacatgttcagaaccttccaggtaactgtcattacttcaaaccaaaggggtggttgctatgtaagtaaagcaatagcagcatgactgactccatggtgttatgtcattacagttgatggtggtgtcactcattgcaatgacactcttcttccgtacgaaaatgaaacgtgattctgtgaccagcgggggcatctacatgggcgcactcttctttggtgtgcttatgatcatgttcaatggtttctcagagcttgcgctcactgtctttaagttgcctgttttcttcaagcagagggatctccttttttatcctgcatggtcgtacactataccctcatggattctcaagatcccaatcacgtttattgaggttggtgggtatgtgttcttaacatactacgtcattgggtttgactcaaacgtgggcaggtgagatttattgagattatatatttcacaggtgtataatcagctatatcttactatagtgctgctctgcattgttctgagagtatttgtcttttttttgtttaccccagcttcttcaagcagtatttgctcatgttagcaatcaatcagatggcgggatcacttttccgattcattggtggggcagcgaggaacatgattgttgcaaatgtctttgcatcattcatgctgctaatttttatggtattgggtggattcattctagcaagaggtaaatgctcaccattatctgtctgagaagtgcttggtttgcactttttatcaaaagctaagtgttccattctgttcgacttgcagagcaagtgaagaaatggtggatttggggctactggatatccccgatgatgtacgcccagaatgccatctcagttaatgaactcatggggcacagctggaacaaaattgtgaatagctctgcctccaatgagacccttggtgtgcaagtcctcaagtcccgtggagtattccctgaagccaggtggtattggattgggtttggtgcaatgatcggcttcaccatccttttcaatgctctcttcacccttgcccttacatacctcaggcgtgagtataccttgagaactgatttgctctttttcctagagttggctatatccaaacatgagaatgatttcatcttgtgatttacagcatatggaaattcccgtcagtcagtatcagaagaggaactgaaagagaagcgtgccaatctgaatggtgagattgtgggtgacgttcacttgtcatctggaagtacgcgtaggccaatgggaaacggcactgaaaatgattcaacaattgttgatgatgatactgaggttactcaaagggggatggttctcccatttactccgctttcactcagctttgacaatgtcagatattctgttgacatgccacaggtaaaatatggaagaactcctaccaaatcaggaattgatcattagtttgcatttttctaactttcagcgtgaaattaatttcaggaaatgaaagcacaaggtgtagctgatgaccggttggagctcctcaaaggtgttagtggttcattcaggccaggggtgttgactgcactaatgggtgtcagtggtgctggcaagacaacactgatggatgtattggctgggagaaagacaggtgggtacattgaaggaagcatcaacatttcaggatatccaaagaaacaagagacttttgcacgtgtgtctggatactgtgagcagaacgatatccactcaccgcaggtcacagtctatgagtcgctacttttctcagcatggctccgtcttcctgaggatgtagattccaacactagaaaggtccgtcaaacatttttttttgctattcctacctatacttgatatagatagatagtagcttacctttgtgtatgcagatgttcattgaggaggtgatggagcttgtggagctcaagtcactgagagatgctttggttgggcttcctggagtgaatggtctgtccactgaacaaagaaagaggctaacaatcgcagtggagcttgttgcaaacccttcgattatattcatggacgagccaacctcagggcttgatgcacgagcagctgcaattgtgatgaggacagtgaggaacactgttaatactggcagaactgtggtgtgcacaattcatcagcctagcattgacatatttgaagcatttgatgaggtgagtgtgattctactttggagattcgtaccattttctcctcagatattaggatacattgcggaaagcccaaaaatcaattgattatggctgtgtttctaaactacctggatgatttgactaatatattttttgcttgcagcttttcctgatgaagcgaggtggtgaagagatctatgctggtccactaggccatcattcttcggagctgatcaagtattttgaggtaagtgatattacactaattctaatatacctcaatgacatttcttcaaaattactgattcaatcgcatctttgtgtatcatccagagtatcccaggggtcagcaaaatcaaagatggctataacccagcaacatggatgttggaggtgacaacaattggtcaagagcaggcacttggtgttgattttagtgatatatacaagaagtctgaactttaccagtgagtaacttgcttttaatcctaattgttgtttcatctttctgcaaagcaatttttttttgcaatatgccatgtaacactgattgctaccttattcaggaggaacaaggccttgataaaggacctgagccaaccagcccccgattcaagtgacctgtatttccctacccaatattctcagtcttctttaacacaatgcatggcttgcctgtggaagcaaaacctgtcatactggaggaaccctccttacaatgccgttaggttctttttcactactgtcattgctcttctctttggtaccatcttctgggaccttggcggcaaagtgtaagtaaaatgccactttctatatgcaaagagggtgtaccttagaaatcttattcatttcgtgcttcttaatccaggacgaagtcacaagacttgttcaatgccatggggtcaatgtatgcagcagtgctgttcatcggtgtcatgaactgtacatctgttcagccagtggtggccgtggagcggacagtcttttaccgtgaaagggctgccggcatgtactcggcgtttccatatgcatttggccaggtgaatggtcctcctgcaactgacattgagtcctggttgttgcatccttgagatccagatactgattaattcctctttcaggttgtcattgagatcccatacacactggttcaggctactgtatacgggatcatagtgtatgcgatgattgggttcgagtggacggctgccaagttcttctggtacctcttcttcatggtcttcacgctcctctacttcacattctacggcatgatggcggtcggcctgacaccgaactaccacattgcctcgatcgtctcatcggcgttctacgccatctggaatctcttctccggcttcgtcatcccccgacctgtaagtttcgcattcccaattgcccctcattcttccatacacttccaactccattgggtgctcatctctgtttgtgcctgatgatgtttcagagagtcccaatctggtggagatggtattgctgggcgtgccccgtcgcgtggacgctgtacggcctcgtcgtctcccagttcggtgacatcgagacgccgatggaagacggcacccctgtgaaggtgtttgtggagaactacttcggcttcaagcacagctggttgggctgggtggccaccgtggtcgctgccttcgctttcctcttcgcttccttgtttggcttcgctatcatgaagttcaacttccagaagagatgatgatgacaagggatattacattcattgagttgcaaacgctacctgaaatttgtgcatatcattggatctaaagaatttttttttgttgccattagaatattgtaaatcataccagcctttcccccttatttttatagaaagattgtactactgttacacctagtaattttgttattagtacccttctttttatagaaagatggtactacttttatttttaatttttatatggggttgtctagtgttcagttgactgaa</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050074.1 RefSeq:Os01g0609300]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 1]]
| |
| − | [[Category:Chromosome 1]]
| |
Ospdr9, encodes apleiotropic drug resistance (PDR)-type ATP-binding (ABC) protein in plant responses to environmental stresses [1].
Annotated Information
Function
Ospdr9 gene locates in chromosome 1 with 21 exons and 20 introns [2]. It is consist of an open reading frame (4371 bp) and a 3’untranslated region (313 bp), including a poly-A tail of 18bp. It encodes a pleiotropic drug resistance (PDR)-type ATP-binding (ABC) protein [1]. There are 23 members in PDR protein subfamily in rice [3], and OsPDR9 protein of 1457 amino acids is predicted to be 163 kDa with a calculated pI of 6.7. Two hydrophilic ABC domains with the length of 150 amino acids compose the full-size ABC transporter protein OsPDR9, and both of the two domains have a well-conserved Walker A motif and less conserved Walker B and ABC signature sequences [4]. According to TMHMM2.0 program, OsPDR9 is predicted to have two hydrophobic integral membrane domains, each with six potential transmembrane-spanning α-helices (TMS).
Expression
Figure 2. Early
ospdr9 expression in rice roots in response to various stresses. RT-PCR products of
ospdr9 and
rac1 (upper panels) and
adh1 and
rac1 (lower panels) were separated on 1.1% agarose gels and stained with ethidium bromide.3RT lanes show typical 3RT reactions in which reverse transcriptase was omitted. gDNA lanes show PCR amplifications on genomic DNA with each primer pair in the same conditions. Sizes of cDNA (left) or gDNA products (right) are indicated. A: RNA was prepared from the roots of rice seedlings that were incubated on growth medium (controls C1,C2 and C3), incubated on growth medium supplemented with PEG (15 or 13.5%), kept in the cold (4oC, CO), exposed to heat (42oC, H), or incubated on growth medium supplemented with ZnSO4 (5 or 2.5 mM) for 2 h. B: Rice seedlings were incubated on growth medium (controls C4 and C5) or on growth medium supplemented with KCl (5 mM), MgSO4 (2.5 mM), CoCl2 (250 WM and 2.5 mM), NiCl2 (250 WM and 2.5 mM), or ethanol (0.5% and 5%) for 2 h. Equal amounts of rac1 were detected, except during ethanol toxicity (5%) which caused a decline of the rac1 messenger(from reference
[1]).
When there is not stress, ospdr9 is not constitutively expressed in roots as well as in the shoot of rice seedlings. However, a significant amount of ospdr9 transcription can be detected in rice roots by RT-PCR expression analysis after exposing to PEG (13.5 and 15%) within 2 h [1]. But a 2 h exposure to low or high temperatures (4oC and 42oC) does not induce the expression of Ospdr9 (Fig. 2A). Toxic chemicals, for example, ZnSO4 (2.5 or 5 mM), cobalt and nickel chloride (250 WM and 2.5 mM), markedly induce ospdr9 in rice roots (Fig. 2B); Co generally causes a stronger ospdr9 expression than Ni. Low oxygen stress is a stronger inducer of ospdr9 than salt shock in rice roots, for the expression of ospdr9 induced by salt stress is not only being delayed but also at low levels. It was also suggested that toxic and hypoxic PEG effects were more important than osmotic PEG effects in generating the marked PEG response of ospdr9 [1].
In addition, micromolar heavy metals cadmium and zinc concentrations markedly induce ospdr9 in rice roots specifically and rapidly, which may due to the similar mechanism of root-to-shoot metal transport barriers, as observed in Arabidopsis [5]. DTT (Fig. 6) is stronger inducer of ospdr9 than hydrogen peroxide in rice roots, which suggested a response to redox perturbations that favour the reduced state [1]. Moreover, the non-thiol antioxidant ascorbic acid also induced ospdr9 in rice roots (Fig. 6). The strong oxidant hydrogen peroxide also induced ospdr9 expression, though at three times lower levels than DTT (Fig. 6), which indicated a response to oxidative conditions as well[1].
Figure 6. Ospdr9 expression in rice roots in response to DTT, hydrogen peroxide and ascorbic acid. RT-PCR expression patterns of
ospdr9 and
rac1. Rice seedlings were incubated on growth medium (controls C12 and C13) or on growth medium supplemented with 5 mM DTT or 5 mM H2O2 for 1, 2, 3, 4 and 6 h or on 5 mM ascorbic acid (ASC) for 3 and 4 h. Equal amounts of rac1 were detected in all lanes. (from reference
[1]).
Jasmonates induced more than half of the PDR genes expresses in roots of rice, and among them ospdr9 is the highest level. Data from method of expressed sequence tag indicated that ospdr9 was expressed at high levels in callus under various treatments, including ABA, and this probably reflected the stress and phytohormonal response of the gene that observed in roots[6].
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
- Department of Biology, Faculty of Science, University of Ottawa, Canada.
- Montreal General Hospital, Canada.
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Moons A: Ospdr9, which encodes a PDR-type ABC transporter, is induced by heavy metals, hypoxic stress and redox perturbations in rice roots. FEBS Lett 2003, 553:370-376.
- ↑ Goff, S.A., Ricke, D. and Lan, T.-H. et al. A draft sequence of the rice genome (Oryza sativa L. spp. Japonica) (2002) Science 296, 92-100.
- ↑ Jasinski, M., Ducos, E., Martinoia, E. and Boutry, M. The ATP-Binding Cassette Transporters: Structure, Function, and Gene Family Comparison between Rice and Arabidopsis (2003) Plant Physiol. 131, 1169-1177.
- ↑ Bairoch, A. PROSITE: a dictionary of sites and patterns in proteins (1992). Nucleic Acids Res. 20 (Suppl.), 2013-2018.
- ↑ Bovet, L., Eggmann, T., Meylan-Bettex, M., Polier, J., Kammer, P., Marin, E., Feller, U. and Martinoia, E. Transcript levels of AtMRPs after cadmium treatment: induction of AtMRP3. (2003) Plant. Cell Environ. 26, 371-381.
- ↑ Moons A .Transcriptional profiling of thePDRgene family in rice roots in response to plant growth regulators, redox perturbations and weak organic acid stresses. (2008). Planta. 229:53–71.
Structured Information