Difference between revisions of "Os01g0710200"

From RiceWiki
Jump to: navigation, search
m
 
(20 intermediate revisions by one other user not shown)
Line 1: Line 1:
 
This is the Oryza sativa Polyamine oxidase 1(OsPAO1)encoding gene.
 
This is the Oryza sativa Polyamine oxidase 1(OsPAO1)encoding gene.
 
==Annotated Information==
 
==Annotated Information==
 +
Oryza sativa contains seven genes encoding polyamine oxidases, termed OsPAO1 to OsPAO7 based on their chromosomal number and gene ID number.
 +
[[File:Nisw2.jpg]]                                       
 
===Function===
 
===Function===
Please input function information here.
+
Polyamine oxidases (PAOs) are FAD-dependent enzymes involved in polyamine (PA) catabolism. In plants, the major PAs are the diamine, putrescine (Put), triamine, spermidine (Spd), tetrraamines, spermine (Spm) and thermospermine (T-Spm). These aliphatic amines of small molecular mass are involved in various biological processes, as growth factors, they play important roles in plant development, sex differentiation, fruit ripening, senility and adversity adapting.
 +
 +
In plants, the concentrations of all the PAs are regulated by a dynamic balance between biosynthesis and catabolism. In the latter process, two kinds of enzymes are involved: a copper-dependent diamine oxidase and a flavine adenine dinucleotide (FAD)-dependent polyamine oxidases (PAOs). Recent studies revealed that PAOs are not only active in the terminal catabolism but also in a polyamine back-conversion pathway.
 +
 
 +
Rice plant appears to contain two types of PAO enzymes: one functioning as a back-conversion enzyme, and the other as a terminal catabolism enzyme. It has been demonstrated that OsPAO1, as well as OsPAO3, OsPAO4 and OsPAO5, can catalyze the back-conversion reactions of some PAs. At different pH, T-Spm, Spm or other PAs can be chosen as the preferred substrate of OsPAO1; both these substrates will be converted to Spd but no further to Put.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
Compared with other PAOs, expression of OsPAO1 appears to be quiet low under physiological conditions, and mainly localizes to the cytoplasm of onion epidermal cells. While expression of OsPAO1 can be markedly induced by spermine (Spm) or T-Spm treatmemt in rice roots, a plausible explanation of this tetraamine-induced OsPAO1 production is that excess amount of tetraamines may be detrimental for root metabolism or growth and thus OsPAO1 is inductively produced to catabolize them immediately.  
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
Phylogenetic analysis of the amino acid sequences of the seven O. sativa PAOs, five Arabidopsis PAOs, and several other plant PAOs have been performed [Fig.2]. Plant PAOs were divided into four clades: clade I includes Arabidopsis AtPAO1, tobacco NtPAO, and apple MdPAO1. Clade II comprises the three rice members, OsPAO2, OsPAO6, and OsPAO7, along with maize ZmPAO, barley HvPAO1, and HvPAO2. Clade III is built by OsPAO1, Brassica juncea BjPAO, and AtPAO5. In clade IV, three rice PAOs, OsPAO3, OsPAO4, and OsPAO5 were grouped together with Arabidopsis peroxisome-localized members, AtPAO2, AtPAO3, and AtPAO4.
 +
[[File:Nisw1.jpg]]
  
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
Graduate School of Life Sciences, Tohoku University, Japan
 +
 
 +
Faculty of Pharmaceutical Sciences, Josai University, Japan
 +
 
 +
Biodiversity and Climate Research Center, Laboratory Centre, German
  
 
==References==
 
==References==
Please input cited references here.
+
 
 +
Liu, T., Kim, D.W., Niitsu, M., Maeda, S., Watanabe, M., Kamio, Y., Berberich, T., and Kusano, T. (2014a). Polyamine Oxidase 7 is a Terminal Catabolism-Type Enzyme in Oryza sativa and is Specifically Expressed in Anthers. Plant & cell physiology.
 +
 
 +
Liu, T.B., Kim, D.W., Niitsu, M., Berberich, T., and Kusano, T. (2014b). Oryza sativa polyamine oxidase 1 back-converts tetraamines, spermine and thermospermine, to spermidine. Plant Cell Rep 33, 143-151.
 +
 
 +
Ono, Y., Kim, D.W., Watanabe, K., Sasaki, A., Niitsu, M., Berberich, T., Kusano, T., and Takahashi, Y. (2012). Constitutively and highly expressed Oryza sativa polyamine oxidases localize in peroxisomes and catalyze polyamine back conversion. Amino Acids 42, 867-876.
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0710200|
 
Description = Amine oxidase domain containing protein|
 
Version = NM_001050573.1 GI:115439516 GeneID:4327828|
 
Length = 1539 bp|
 
Definition = Oryza sativa Japonica Group Os01g0710200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:31269225..31270763|
 
CDS = 31269225..31270763|
 
GCID = <gbrowseImage1>
 
name=NC_008394:31269225..31270763
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:31269225..31270763
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggtggcgaagaagccgagggttgtggtggtgggcgcggggatatcgggcctcgcggcggcgcaccggctgtgcggcgcgggcggggacaggttcgaggtggcggtggtggaggccggcgaccgagtcggcggccggatcctcacgtccgagttcgccggccaccgggtcgagatgggcgccacgtgggtgcagggcgtcgtcgggagccccgtgtacgctctggcgcgcgacgccggcgcgctcggggaggaggagggtcgtggtctcccgtacgagcgcatggacggcttccccgaccgcgtgctgaccgtcgcagagggcggcgaggtcgtcgacgcggacacggtggctggcccgatcgaggagctgtacaggggcatgatggaggccgcgcgcgccggcgaggctggtggtggaggcggcgtggaggagtacctgcgccgtggcctacgggcgtaccaggcggcgcggtctgccggcggcggcggcggcggcggcaaggagcttgaggaggtggacgaggcgctgctcgccatgcacatcaaccgggagcggaccgacacctccgccgacgacctcggcgacctcgacctcaccgccgagggcgagtaccgcgacttccccggcgaacacgtcacgattcccggcggctactcccgcgtggtcgagcgcctcgccgctgcgctcccgcccggcaccgtccgcctcggactccgtctccgccgtctcaagtggggcggaacccctgtccgcctccacttcgcggatggcgcgccgccgctcaccgccgaccacgtcatcctcacggtctcgctgggcgtcctcaaggccagcctcggcaacaaggacaccgccggcgttggcgcggccgccatcgccttcgacccgccgctcccgcctttcaagcgcgaggccgtcgcgcgcctcggcttcggcgtcgtgaacaagctgttcatggaggtggaggccgtggcgccatcggaaccggaggacgtcgccggcgtgcagccggcggcggcgggcttcccgttcctgcacatggcgttccggggacacgtgtccaagatcccgtggtggatgcgcggcacggagtcgatctgccccgtccacgcgggctccaccgtggcgctggcgtggttcgccggccgggaggcggcgcacctcgagtccctccccgacgacgacgtcatccgcggggcccacgccacgctggactccttcctcccggcggcgccacggtggagggtgaggaggatcaagcggagcgggtgggccacggacccgctcttcctcgggtcatacagctacgtggccgtcggatcgagcggcgacgacctcgatcgcatggccgaaccgctgccacgtgggccagacgccgccgccgacgagcggccgccgtcgccgcggctgctgttcgccggcgaggcgacgcaccgcacgcactactcaacgacgcacgccgcgtacctgagcggcgtgcgcgaggctaaccggctgctgcaacactaccgcggcggagcgaatcacaccacgtag</cdnaseq>|
 
AA = <aaseq>MVAKKPRVVVVGAGISGLAAAHRLCGAGGDRFEVAVVEAGDRVG                    GRILTSEFAGHRVEMGATWVQGVVGSPVYALARDAGALGEEEGRGLPYERMDGFPDRV                    LTVAEGGEVVDADTVAGPIEELYRGMMEAARAGEAGGGGGVEEYLRRGLRAYQAARSA                    GGGGGGGKELEEVDEALLAMHINRERTDTSADDLGDLDLTAEGEYRDFPGEHVTIPGG                    YSRVVERLAAALPPGTVRLGLRLRRLKWGGTPVRLHFADGAPPLTADHVILTVSLGVL                    KASLGNKDTAGVGAAAIAFDPPLPPFKREAVARLGFGVVNKLFMEVEAVAPSEPEDVA                    GVQPAAAGFPFLHMAFRGHVSKIPWWMRGTESICPVHAGSTVALAWFAGREAAHLESL                    PDDDVIRGAHATLDSFLPAAPRWRVRRIKRSGWATDPLFLGSYSYVAVGSSGDDLDRM                    AEPLPRGPDAAADERPPSPRLLFAGEATHRTHYSTTHAAYLSGVREANRLLQHYRGGA                    NHTT</aaseq>|
 
DNA = <dnaseqindica>1..1539#atggtggcgaagaagccgagggttgtggtggtgggcgcggggatatcgggcctcgcggcggcgcaccggctgtgcggcgcgggcggggacaggttcgaggtggcggtggtggaggccggcgaccgagtcggcggccggatcctcacgtccgagttcgccggccaccgggtcgagatgggcgccacgtgggtgcagggcgtcgtcgggagccccgtgtacgctctggcgcgcgacgccggcgcgctcggggaggaggagggtcgtggtctcccgtacgagcgcatggacggcttccccgaccgcgtgctgaccgtcgcagagggcggcgaggtcgtcgacgcggacacggtggctggcccgatcgaggagctgtacaggggcatgatggaggccgcgcgcgccggcgaggctggtggtggaggcggcgtggaggagtacctgcgccgtggcctacgggcgtaccaggcggcgcggtctgccggcggcggcggcggcggcggcaaggagcttgaggaggtggacgaggcgctgctcgccatgcacatcaaccgggagcggaccgacacctccgccgacgacctcggcgacctcgacctcaccgccgagggcgagtaccgcgacttccccggcgaacacgtcacgattcccggcggctactcccgcgtggtcgagcgcctcgccgctgcgctcccgcccggcaccgtccgcctcggactccgtctccgccgtctcaagtggggcggaacccctgtccgcctccacttcgcggatggcgcgccgccgctcaccgccgaccacgtcatcctcacggtctcgctgggcgtcctcaaggccagcctcggcaacaaggacaccgccggcgttggcgcggccgccatcgccttcgacccgccgctcccgcctttcaagcgcgaggccgtcgcgcgcctcggcttcggcgtcgtgaacaagctgttcatggaggtggaggccgtggcgccatcggaaccggaggacgtcgccggcgtgcagccggcggcggcgggcttcccgttcctgcacatggcgttccggggacacgtgtccaagatcccgtggtggatgcgcggcacggagtcgatctgccccgtccacgcgggctccaccgtggcgctggcgtggttcgccggccgggaggcggcgcacctcgagtccctccccgacgacgacgtcatccgcggggcccacgccacgctggactccttcctcccggcggcgccacggtggagggtgaggaggatcaagcggagcgggtgggccacggacccgctcttcctcgggtcatacagctacgtggccgtcggatcgagcggcgacgacctcgatcgcatggccgaaccgctgccacgtgggccagacgccgccgccgacgagcggccgccgtcgccgcggctgctgttcgccggcgaggcgacgcaccgcacgcactactcaacgacgcacgccgcgtacctgagcggcgtgcgcgaggctaaccggctgctgcaacactaccgcggcggagcgaatcacaccacgtag</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050573.1 RefSeq:Os01g0710200]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 04:54, 14 May 2015

This is the Oryza sativa Polyamine oxidase 1(OsPAO1)encoding gene.

Annotated Information

Oryza sativa contains seven genes encoding polyamine oxidases, termed OsPAO1 to OsPAO7 based on their chromosomal number and gene ID number. Nisw2.jpg

Function

Polyamine oxidases (PAOs) are FAD-dependent enzymes involved in polyamine (PA) catabolism. In plants, the major PAs are the diamine, putrescine (Put), triamine, spermidine (Spd), tetrraamines, spermine (Spm) and thermospermine (T-Spm). These aliphatic amines of small molecular mass are involved in various biological processes, as growth factors, they play important roles in plant development, sex differentiation, fruit ripening, senility and adversity adapting.

In plants, the concentrations of all the PAs are regulated by a dynamic balance between biosynthesis and catabolism. In the latter process, two kinds of enzymes are involved: a copper-dependent diamine oxidase and a flavine adenine dinucleotide (FAD)-dependent polyamine oxidases (PAOs). Recent studies revealed that PAOs are not only active in the terminal catabolism but also in a polyamine back-conversion pathway.

Rice plant appears to contain two types of PAO enzymes: one functioning as a back-conversion enzyme, and the other as a terminal catabolism enzyme. It has been demonstrated that OsPAO1, as well as OsPAO3, OsPAO4 and OsPAO5, can catalyze the back-conversion reactions of some PAs. At different pH, T-Spm, Spm or other PAs can be chosen as the preferred substrate of OsPAO1; both these substrates will be converted to Spd but no further to Put.

Expression

Compared with other PAOs, expression of OsPAO1 appears to be quiet low under physiological conditions, and mainly localizes to the cytoplasm of onion epidermal cells. While expression of OsPAO1 can be markedly induced by spermine (Spm) or T-Spm treatmemt in rice roots, a plausible explanation of this tetraamine-induced OsPAO1 production is that excess amount of tetraamines may be detrimental for root metabolism or growth and thus OsPAO1 is inductively produced to catabolize them immediately.

Evolution

Phylogenetic analysis of the amino acid sequences of the seven O. sativa PAOs, five Arabidopsis PAOs, and several other plant PAOs have been performed [Fig.2]. Plant PAOs were divided into four clades: clade I includes Arabidopsis AtPAO1, tobacco NtPAO, and apple MdPAO1. Clade II comprises the three rice members, OsPAO2, OsPAO6, and OsPAO7, along with maize ZmPAO, barley HvPAO1, and HvPAO2. Clade III is built by OsPAO1, Brassica juncea BjPAO, and AtPAO5. In clade IV, three rice PAOs, OsPAO3, OsPAO4, and OsPAO5 were grouped together with Arabidopsis peroxisome-localized members, AtPAO2, AtPAO3, and AtPAO4. Nisw1.jpg


Labs working on this gene

Graduate School of Life Sciences, Tohoku University, Japan

Faculty of Pharmaceutical Sciences, Josai University, Japan

Biodiversity and Climate Research Center, Laboratory Centre, German

References

Liu, T., Kim, D.W., Niitsu, M., Maeda, S., Watanabe, M., Kamio, Y., Berberich, T., and Kusano, T. (2014a). Polyamine Oxidase 7 is a Terminal Catabolism-Type Enzyme in Oryza sativa and is Specifically Expressed in Anthers. Plant & cell physiology.

Liu, T.B., Kim, D.W., Niitsu, M., Berberich, T., and Kusano, T. (2014b). Oryza sativa polyamine oxidase 1 back-converts tetraamines, spermine and thermospermine, to spermidine. Plant Cell Rep 33, 143-151.

Ono, Y., Kim, D.W., Watanabe, K., Sasaki, A., Niitsu, M., Berberich, T., Kusano, T., and Takahashi, Y. (2012). Constitutively and highly expressed Oryza sativa polyamine oxidases localize in peroxisomes and catalyze polyamine back conversion. Amino Acids 42, 867-876.

Structured Information