Difference between revisions of "Os01g0897700"

From RiceWiki
Jump to: navigation, search
(References)
 
(13 intermediate revisions by one other user not shown)
Line 5: Line 5:
 
Please input function information here.
 
Please input function information here.
  
This gene is cloned from Oryza sativa. It belongs to a large family of multi-domain proteins that exist in yeast, plants, and animals, and they participate in linear actin polymer assembly. Formins are identified by the highly conserved formin homology 2 (FH2) domain. Most plant formins contain a more variable formin homology 1 (FH1) domain[1].Based on phylogenies derived from the conserved FH2 sequences and the organization of their N-terminal domains, plant formins can be mainly divided into two distinct subfamilies: there are 11 class I formins (OsFH1, OsFH2, OsFH4,
+
This gene is cloned from Oryza sativa. It belongs to a large family of multi-domain proteins that exist in yeast, plants, and animals, and they participate in linear actin polymer assembly. Formins are identified by the highly conserved formin homology 2 (FH2) domain. Most plant formins contain a more variable formin homology 1 (FH1) domain<ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>.Based on phylogenies derived from the conserved FH2 sequences and the organization of their N-terminal domains, plant formins can be mainly divided into two distinct subfamilies: there are 11 class I formins (OsFH1, OsFH2, OsFH4,OsFH8 to OsFH11, and OsFH13 to OsFH16) and five class II formins (OsFH3, OsFH5 to OsFH7, and OsFH12) in O.sativa<ref name="ref3"> Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.</ref>.  
OsFH8 to OsFH11, and OsFH13 to OsFH16) and five class II formins (OsFH3, OsFH5 to OsFH7, and OsFH12) in O.sativa[3].  
+
Vesicle trafficking, cytoskeleton reorganization, and cell wall loosening and synthesis are major driving forces for root-hair elongation. Rice formin 1 (OsFH1) is important for root-hair development. Besides,the Osfh1 knock-out mutants showed a defect in root-hair elongation. Aerobic growth rescues the genetic defect of OsFH1. Therefore, it is reasonable to speculate that cellular differences that are crucial for root-hair growth processes might exist between roots grown submerged in liquid versus roots grown in air. OsFH1is most required for elongation processes when root hairs are grown under the submerged condition<ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>.
Vesicle trafficking, cytoskeleton reorganization, and cell wall loosening and synthesis are major driving forces for root-hair elongation. Rice formin 1 (OsFH1) is important for root-hair development. Besides,the Osfh1 knock-out mutants showed a defect in root-hair elongation. Aerobic growth rescues the genetic defect of OsFH1. Therefore, it is reasonable to speculate that cellular differences that are crucial for root-hair growth processes might exist between roots grown submerged in liquid versus roots grown in air. OsFH1is most required for elongation processes when root hairs are grown under the submerged condition[1].
 
 
[[File:OsFH1-1.png]]
 
[[File:OsFH1-1.png]]
  
Line 16: Line 15:
 
Since rice is grown in water-logged paddy fields, rice root hairs are exposed to physical and chemical conditions that are different from those  
 
Since rice is grown in water-logged paddy fields, rice root hairs are exposed to physical and chemical conditions that are different from those  
 
of upland plants such as wheat and corn. Compared with Arabidopsis, only a few genes have been reported to regulate root hair development in rice.
 
of upland plants such as wheat and corn. Compared with Arabidopsis, only a few genes have been reported to regulate root hair development in rice.
The phenotypic effect of OsFH1on root hair development was verified by using three independent mutants, one point mutation and two T-DNA insertions[2].  
+
The phenotypic effect of OsFH1on root hair development was verified by using three independent mutants, one point mutation and two T-DNA insertions<ref name="ref2"> Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.</ref>.  
 
OsFH1-mediated cellular processes are required for the elongation of submerged root hairs. It is likely that submergence induces physiological or
 
OsFH1-mediated cellular processes are required for the elongation of submerged root hairs. It is likely that submergence induces physiological or
cellular changes that interfere with root hair elongation and that OsFH1overcomes these changes via some physiological factor involved in root hair elongation. Considering that rice grows in water-logged soil, OsFH1has an important role to play in rice plant survival under this condition. The physiological factor that mediates the effect of OsFH1 on root hair elongation remains to be identified.
+
cellular changes that interfere with root hair elongation and that OsFH1overcomes these changes via some physiological factor involved in root hair elongation. Considering that rice grows in water-logged soil, OsFH1has an important role to play in rice plant survival under this condition. The physiological factor that mediates the effect of OsFH1 on root hair elongation remains to be identified<ref name="ref2"> Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.</ref>.
  
 
===Evolution===
 
===Evolution===
Line 24: Line 23:
  
 
Formin family members are defined by the presence of a FH2 domain. There are at least 21 putative formin genes in Arabidopsis, whereas rice genomes contain 16 putative formin genes. This gene is coded by Os01g67240 and Os01g67240 has been annotated as aformin-like protein 1 in public databases.  
 
Formin family members are defined by the presence of a FH2 domain. There are at least 21 putative formin genes in Arabidopsis, whereas rice genomes contain 16 putative formin genes. This gene is coded by Os01g67240 and Os01g67240 has been annotated as aformin-like protein 1 in public databases.  
Further sequence analysis indicated that it belongs to the rice formin family that contains FH1and FH2 domains.
+
Further sequence analysis indicated that it belongs to the rice formin family that contains FH1and FH2 domains<ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 39: Line 38:
 
Please input cited references here.
 
Please input cited references here.
  
1. Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.
+
<references>
2. Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.
+
<ref name="ref1">Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>
3. Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.
+
<ref  name="ref2">Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.</ref>
 +
<ref name="ref3">Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0897700|
 
Description = Similar to FH protein NFH1|
 
Version = NM_001051625.1 GI:115441620 GeneID:4325107|
 
Length = 1054 bp|
 
Definition = Oryza sativa Japonica Group Os01g0897700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:40769673..40770726|
 
CDS = 40769990..40770463|
 
GCID = <gbrowseImage1>
 
name=NC_008394:40769673..40770726
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:40769673..40770726
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggactccgacgtgctaagcagctatgtctcgaaacttgctggaggaatagagaagatcactgaggtgttgcggttgaatgaagaagtcaagtccagggaagatgcatggaggttccatgattcaatgcagaagttcttgaagagggctgatgacgacatcatcagggttcaggctcaggagagcgttgcgctatcacttgtgaaggagatcaccgagtacttccatggtgactctgcgaaagaggaagctcaccctttcaggatcttcatggtggtcagggatttcctctcagttcttgatcaagtctgcaaggaagttggcaggatcaatgaccgcacgatcgctagctcggtgcgccatttcccagtacccgtcaacccaatgatgccacagttgttccccaggattcatgctttgagagctggaatctcagatgatgaaagttcagccacttcagcatcatcaccttga</cdnaseq>|
 
AA = <aaseq>MDSDVLSSYVSKLAGGIEKITEVLRLNEEVKSREDAWRFHDSMQ                    KFLKRADDDIIRVQAQESVALSLVKEITEYFHGDSAKEEAHPFRIFMVVRDFLSVLDQ                    VCKEVGRINDRTIASSVRHFPVPVNPMMPQLFPRIHALRAGISDDESSATSASSP</aaseq>|
 
DNA = <dnaseqindica>264..737#atcgcggcgatgcacacgcgttcaagcttgatactctactcaaattggttgatgtcaaaggcactgatggcaagactacacttttgcattttgtcgtgcaggagattatccgaacggagggctcccacctctctgctagcaaccaatcaactccacgaactcaggcaaaccctttacgggacgagctcgagtgcaaaaagcttggcctccaggtagtggctggcctcggaaacgagctcagcaatgtcaagaaggcagctgccatggactccgacgtgctaagcagctatgtctcgaaacttgctggaggaatagagaagatcactgaggtgttgcggttgaatgaagaagtcaagtccagggaagatgcatggaggttccatgattcaatgcagaagttcttgaagagggctgatgacgacatcatcagggttcaggctcaggagagcgttgcgctatcacttgtgaaggagatcaccgagtacttccatggtgactctgcgaaagaggaagctcaccctttcaggatcttcatggtggtcagggatttcctctcagttcttgatcaagtctgcaaggaagttggcaggatcaatgaccgcacgatcgctagctcggtgcgccatttcccagtacccgtcaacccaatgatgccacagttgttccccaggattcatgctttgagagctggaatctcagatgatgaaagttcagccacttcagcatcatcaccttgatcaccagtagtctgccaatagaaatttttcgcagagtactgtgggaaacctccatagggcagagggagaccaacggcgacggggtgtcaaatttttttttgaaccttttgtacctgtagattatagaatgtaagaagtttttttgcaaatatttatttctatatataagaggagataaaatctagatcagaggaggaaataagcagttcatgtgtttgtcatcttcagtctgtacatgacacgaggtagtgaaacagcctgtacaatgtactaacaatttcaagtatggccagtctgcagaattcaaaggtaagctg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051625.1 RefSeq:Os01g0897700]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 05:05, 14 May 2015

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

This gene is cloned from Oryza sativa. It belongs to a large family of multi-domain proteins that exist in yeast, plants, and animals, and they participate in linear actin polymer assembly. Formins are identified by the highly conserved formin homology 2 (FH2) domain. Most plant formins contain a more variable formin homology 1 (FH1) domain[1].Based on phylogenies derived from the conserved FH2 sequences and the organization of their N-terminal domains, plant formins can be mainly divided into two distinct subfamilies: there are 11 class I formins (OsFH1, OsFH2, OsFH4,OsFH8 to OsFH11, and OsFH13 to OsFH16) and five class II formins (OsFH3, OsFH5 to OsFH7, and OsFH12) in O.sativa[2]. Vesicle trafficking, cytoskeleton reorganization, and cell wall loosening and synthesis are major driving forces for root-hair elongation. Rice formin 1 (OsFH1) is important for root-hair development. Besides,the Osfh1 knock-out mutants showed a defect in root-hair elongation. Aerobic growth rescues the genetic defect of OsFH1. Therefore, it is reasonable to speculate that cellular differences that are crucial for root-hair growth processes might exist between roots grown submerged in liquid versus roots grown in air. OsFH1is most required for elongation processes when root hairs are grown under the submerged condition[1]. OsFH1-1.png

Expression

Please input expression information here.

Plant root hair development is regulated by a regulatory network and external conditions, such as hormones, nutrients and physical treatments. Since rice is grown in water-logged paddy fields, rice root hairs are exposed to physical and chemical conditions that are different from those of upland plants such as wheat and corn. Compared with Arabidopsis, only a few genes have been reported to regulate root hair development in rice. The phenotypic effect of OsFH1on root hair development was verified by using three independent mutants, one point mutation and two T-DNA insertions[3]. OsFH1-mediated cellular processes are required for the elongation of submerged root hairs. It is likely that submergence induces physiological or cellular changes that interfere with root hair elongation and that OsFH1overcomes these changes via some physiological factor involved in root hair elongation. Considering that rice grows in water-logged soil, OsFH1has an important role to play in rice plant survival under this condition. The physiological factor that mediates the effect of OsFH1 on root hair elongation remains to be identified[3].

Evolution

Please input evolution information here.

Formin family members are defined by the presence of a FH2 domain. There are at least 21 putative formin genes in Arabidopsis, whereas rice genomes contain 16 putative formin genes. This gene is coded by Os01g67240 and Os01g67240 has been annotated as aformin-like protein 1 in public databases. Further sequence analysis indicated that it belongs to the rice formin family that contains FH1and FH2 domains[1].

Labs working on this gene

Please input related labs here.

Division of Applied Life Science (BK21 Program),Plant Molecular Biology and Biotechnology Research Center(PMBBRC), Gyeongsang National University, Jinju 660-701, Korea Department of Plant Sciences, University of Oxford,South Parks Road, Oxford OX1 3RB, UK Genomics Division, Department of Agricultural Biotechnology,National Academy of Agricultural Science (NAAS),RDA, Suwon, Korea Rice Breeding and Cultivation Division,Department of Rice and Winter Cereal Crop (NICS),RDA, Iksan, Korea Key Laboratory of Cell Proliferation and Regulation Biology of Ministry of Education and College of Life Science,Beijing Normal University,Beijing 100875, China

References

Please input cited references here.

  1. 1.0 1.1 1.2 Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239. Cite error: Invalid <ref> tag; name "ref1" defined multiple times with different content
  2. Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107. Cite error: Invalid <ref> tag; name "ref3" defined multiple times with different content
  3. 3.0 3.1 Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970. Cite error: Invalid <ref> tag; name "ref2" defined multiple times with different content

Structured Information