Difference between revisions of "Os01g0911700"

From RiceWiki
Jump to: navigation, search
(Function)
 
(15 intermediate revisions by one other user not shown)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
The expression of OSVP1 could be detected in embryos as early as 2–3 d after pollination (DAP) and thereafter became preferentially localized to shoot, radicle and vascular tissues during the embryo development at both the mRNA and protein levels.
 
===Function===
 
===Function===
Please input function information here.
 
 
During the mid- to late phase of seed development, the embryo and the aleurone tissue undergo a maturation process, whereby each becomes dormant or quiescent and acquires the ability to tolerate desiccation. The maturation process is associated with the accumulation of characteristic sets of mRNAs and proteins, which are products of the so-called LEA (Late Embryogenesis Abundant protein) genes (Baker et al. 1988, Skriver and Mundy 1990). The phytohormone ABA plays key roles in the control of these events (McCarty 1995, Leung and Giraudat 1998). Genetic loci have been identified in Arabidopsis and maize that are required for the control of maturation processes. The viviparous1 (vp1) mutant of maize has been characterized as an ABA-insensitive mutant, in which various events during seed maturation are blocked (McCarty et al. 1991, Robichaud et al. 1980). At the molecular level, the vp1 mutant fails to accumulate mRNAs of ABA-regulated LEA genes, such as Rab28 (Pla et al. 1989) and the maize homologue of the wheat Em gene (McCarty et al. 1991), as well as the genes for globulin storage proteins (Kriz et al. 1990). The Vp1 gene encodes a transcription factor that can activate the transcription of maturation-associated genes(McCarty et al. 1991, Hattori et al. 1992).
 
During the mid- to late phase of seed development, the embryo and the aleurone tissue undergo a maturation process, whereby each becomes dormant or quiescent and acquires the ability to tolerate desiccation. The maturation process is associated with the accumulation of characteristic sets of mRNAs and proteins, which are products of the so-called LEA (Late Embryogenesis Abundant protein) genes (Baker et al. 1988, Skriver and Mundy 1990). The phytohormone ABA plays key roles in the control of these events (McCarty 1995, Leung and Giraudat 1998). Genetic loci have been identified in Arabidopsis and maize that are required for the control of maturation processes. The viviparous1 (vp1) mutant of maize has been characterized as an ABA-insensitive mutant, in which various events during seed maturation are blocked (McCarty et al. 1991, Robichaud et al. 1980). At the molecular level, the vp1 mutant fails to accumulate mRNAs of ABA-regulated LEA genes, such as Rab28 (Pla et al. 1989) and the maize homologue of the wheat Em gene (McCarty et al. 1991), as well as the genes for globulin storage proteins (Kriz et al. 1990). The Vp1 gene encodes a transcription factor that can activate the transcription of maturation-associated genes(McCarty et al. 1991, Hattori et al. 1992).
 
In Arabidopsis, ABI3, one of the genes required for ABA response in seeds is known to be orthologous to maize VP1 (Giraudat et al. 1992). Mutant seeds with severe abi3 alleles show vivipary and block the expression of LEA and storage protein genes (Parcy et al. 1994). Parcy et al. (1994) have shown that transgenic Arabidopsis ectopically expressing ABI3 can induce expression of seed-specific genes in non-seed tissues in response to ABA. Thus, VP1/ABI3 is considered to function in determining the seed specificity of certain sets of ABA-regulated genes. Homologues of VP1/ABI3 have also been cloned from several plant species such as tobacco (Phillips and Conrad 1994), bean (Bobb et al. 1995), and wild oat Avena fauta (Jones et al. 1997). We have cloned the rice orthologue of VP1 (OSVP1) and have been studying the mechanism of tissue/organ-specific regulation of ABA-responsive genes such as the rice Em (OSEM) gene, in which OSVP1 is expected to play a key role (Hattori et al. 1994, Hattori et al. 1995). VP1/ABI3 functions as a transcription factor by acting on at least two distinct types of cis-elements, namely, ABA-response elements (ABREs) and RY/Sph elements. While VP1/ABI3 acts on ABREs via the interaction with ABRE-binding factors such as TRAB1 and ABI5 (Hobo et al. 1999a, Finkelstein and Lynch 2000, Lopez-Molina and Chua 2000, Nakamura et al. 2001), it directly binds to the RY/Sph element through its own DNA binding domain called the B3-domain (Suzuki et al. 1997).
 
In Arabidopsis, ABI3, one of the genes required for ABA response in seeds is known to be orthologous to maize VP1 (Giraudat et al. 1992). Mutant seeds with severe abi3 alleles show vivipary and block the expression of LEA and storage protein genes (Parcy et al. 1994). Parcy et al. (1994) have shown that transgenic Arabidopsis ectopically expressing ABI3 can induce expression of seed-specific genes in non-seed tissues in response to ABA. Thus, VP1/ABI3 is considered to function in determining the seed specificity of certain sets of ABA-regulated genes. Homologues of VP1/ABI3 have also been cloned from several plant species such as tobacco (Phillips and Conrad 1994), bean (Bobb et al. 1995), and wild oat Avena fauta (Jones et al. 1997). We have cloned the rice orthologue of VP1 (OSVP1) and have been studying the mechanism of tissue/organ-specific regulation of ABA-responsive genes such as the rice Em (OSEM) gene, in which OSVP1 is expected to play a key role (Hattori et al. 1994, Hattori et al. 1995). VP1/ABI3 functions as a transcription factor by acting on at least two distinct types of cis-elements, namely, ABA-response elements (ABREs) and RY/Sph elements. While VP1/ABI3 acts on ABREs via the interaction with ABRE-binding factors such as TRAB1 and ABI5 (Hobo et al. 1999a, Finkelstein and Lynch 2000, Lopez-Molina and Chua 2000, Nakamura et al. 2001), it directly binds to the RY/Sph element through its own DNA binding domain called the B3-domain (Suzuki et al. 1997).
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File:Fig.1.jpg|right|thumb|180px|]]
 +
[[File:Fig.2.jpg|right|thumb|150px|]]
 +
Temporal and spatial regulation of OSVP1 expression during embryo development[http://pcp.oxfordjournals.org/content/43/3/307.full]
 +
Temporal and spatial patterns of OSVP1 expression, at both the mRNA and protein level, were examined by in situ hybridization and immuno-localization analyses. OSVP1 mRNA was not detected in the embryo at 1 DAP (Fig. 1A), but was expressed in the whole embryo by 2 DAP (Fig. 1B). Examination of multiple sections from independent seeds revealed that OSVP1 mRNA became detectable in the embryos of 50–70 µm in length, which corresponded to the mid-globular stage. Until 4 DAP, when the coleoptiles started to differentiate, OSVP1 mRNA was distributed uniformly throughout the embryo (Fig. 1B–D). At 6 DAP, however, the signals became localized to those regions where the shoot and radicle were developing (Fig. 1E). A clearer distribution of OSVP1 mRNA could be observed when all the embryonic organs were fully established (Fig. 1F–H). OSVP1 mRNA could be detected in the vascular tissues, a part of coleoptiles, leaves, shoot meristem, and radicle. Epidermal layers of the scutellum and epiblast also showed stronger signals than the inner tissues of these organs. Although other parts of the embryo appeared to express lower levels of OSVP1, it was not certain whether those signals were above the non-specific background. Overall levels of OSVP1 mRNA appeared to decrease by the mature 20 DAP stage (Fig. 1H) compared to those at 10–15 DAP (Fig. 1F, G). In the endosperm, OSVP1 mRNA was detected only in the aleurone layers, the outermost cell layers, after 6 DAP when they had just differentiated, but not in the inner tissues (Fig. 2A–D).
 +
Spatial distribution of OSVP1 protein during development of the embryo was also examined using antibody against OSVP1. The localization of OSVP1 protein was essentially the same as that of the mRNA throughout embryogenesis (Fig. 3). OSVP1 protein was also detected in the aleurone layers (Fig. 2E–H). In Fig. 3, the protein was first detected at 3 DAP but not at 2 DAP. Although there was a 1-d difference in the earliest time the mRNA and protein could be detected, the actual difference in the developmental stage may be much smaller considering the size of the globular embryo. Examination at higher magnification revealed that signals of OSVP1 protein could be found in the nuclei irrespective of the developmental stages (Fig. 3, 4). This observation provides an additional piece of evidence that (OS)VP1 is a transcription factor. In the radicle, the protein was localized in the meristem, epidermis, central stele and the outer cells, but not in the inner cells of the cortex (Fig. 4A). In contrast to the highly tissue-specific localization of OSVP1 detected in the radicle, the shoot apex exhibited quite uniform expression (Fig. 4). The overall expression pattern of OSVP1 mRNA and protein at the later stages appeared to be localized to those organs and tissues that are still undergoing development or play a vital role in the germination and post-germination phases.
 +
[[File:Fig.3.jpg|right|thumb|150px|]]
 +
[[File:Fig.4.jpg|right|thumb|150px|]]
 +
OsVP1 1improves the tolerance of rice crops against drought and salt by employing multiple strategies in addition to osmotic regulation.[http://link.springer.com/article/10.1007/s12374-010-9135-6#]
 +
To test the effects of double overexpression by both genes on salt tolerance by transgenic rice, we studied 2-week-old seedlings from homozygous lines ofOsVP1 and OsNHX1 as well as DO plants from F2. After treatment with 100 mM NaCl for 3 weeks, WT plants showed leaf chlorosis and gradually died, while plants overexpressing OsVP1, OsNHX1, or both had enhanced tolerance .Respective survival rates for theOsVP1-OE, OsNHX1-OE, and DO lines were 85.33%, 100%, and 100%, all of which were significantly higher than the 38.67% recorded from the WT. Seedling heights, root lengths, and fresh weights were also significantly greater for the transformed lines (Table 1and Fig.3b). Finally, Na+ concentrations in leaves were lower in the transgenics than in the WT (Fig.3c).
 +
Relative water content is an indicator of leaf water status. When WT plants were grown with 100 mM NaCl for 1 week, their RWC values decreased 12%, whereas no significant differences were found among OsVP1-OE, OsNHX1-OE, and DO plants when grown under either normal or high-salt conditions (Fig. 3d). Such treatment also induced a greater accumulation of proline in transgenic plants (Table1). Because proline can potentially lead to osmotic adjustments, it seems that the transgenic plants were able to drive the uptake of additional water by accumulating more soluble substance. To investigate the degree of membrane peroxidation and changes in photosynthesis, we measured MDA contents and net photosynthetic rates under either normal or high-salt conditions. Whereas exposure to excess NaCl increased MDA values in both transgenic and WT plants, those measured from OsNHX1-OE and DO (except OsVP1transformants) were significantly lower (Table1). This suggested that overexpression ofOsNHX1 alleviated salt-induced damage to the membrane system. Under such stress,Pnwas significantly diminished in the WT, whereas that rate was maintained at a near-normal level in the transgenics (Table 1). This indicated that overexpression ofOsVP1, OsNHX1, or both could protect the photosynthesis apparatus of rice plants from salt damage.
 +
After 2 weeks of water-deficit treatment, the leaves of WT seedlings grown at 20% MWC were wilted (Fig. 4a), whereasOsVP1-OE and DO plants exhibited less damage, as defined by their wilting status (Fig.4b). Further analysis revealed that RWC values were higher in OsVP1-OE and
 +
DO leaves than in the WT (Fig.4d). These results suggested that OsVP1could enhance drought tolerance in overexpressing transgenic plants.
 +
When plants are exposed to a moisture deficit, leaf water potential decreases, with the extent of that reduction being reflected by their ability to acquire water from their surroundings. Under normal conditions, we found no significant difference in leaf water potential between transgenic and WT plants. However, that parameter was down-regulated inOsVP1and DO plants under drought stress (Fig.4c), suggesting that this osmotic adjustment was triggered by overexpression of OsVP1.
  
 
===Evolution===
 
===Evolution===
Line 16: Line 28:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo, 113-8657 Japan
 +
 
 +
Center for Molecular Biology and Genetics, Mie University, Tsu, 514-8507 Japan
 +
 
 +
Center for Molecular Biology and Genetics,Mie University,1515 Kamihama-cho,Tsu,514 Japan
 +
 
 +
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058, People’s Republic of China
  
 
==References==
 
==References==
Please input cited references here.
+
<ref name="ref1">Kazumaru Miyoshi, Yasuaki Kagaya, Yuichirou Ogawa,et  al.(2002)Temporal and Spatial Expression Pattern of the OSVP1 and OSEM Genes during Seed Development in Rice. Plant and Cell Physiology.Volume 43: 307-313.</ref>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0911700|
 
Description = Similar to Regulatory protein viviparous-1|
 
Version = NM_001051697.2 GI:297598172 GeneID:4324314|
 
Length = 3799 bp|
 
Definition = Oryza sativa Japonica Group Os01g0911700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:41479033..41482831|
 
CDS = 41479311..41479604,41479844..41479920,41480040..41480086,41480541..41480638,41480859..41480948<br>,41481144..41482626,41482696..41482721|
 
GCID = <gbrowseImage1>
 
name=NC_008394:41479033..41482831
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:41479033..41482831
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggacgcctccgccggctcgtcggccccggcggcggagatcaggggtgaggcggcgagggatgacgtctttttcgctgacgataccttcccgttgctcccggacttcccgtgcctttcttccccgtcaagctcaaccttctcgtcgtcgtcgtcgtcgaactcgtccagcgctttcaccaccgcggcgggagggggttgcggcggtgagccgtccgagccggcctcggcggcggacgggtttggtgagctcgccgacatagaccagctcctcgacctcgcgtcgctgtccgtcccgtgggaggccgagcagccgctgttcccggacgacgttggcatgatgatagaggacgccatgtccgggcaaccgcatcaggcggacgactgtaccggcgacggcgatacgaaggcggtgatggaggcggccgggggaggagacgacgccggcgacgcatgcatggaggggagtgatgcgcccgacgatctgccggcgttcttcatggagtggctcacgagcaaccgtgagtacatctccgccgacgacctccgcagcatccgcctccgccgatccaccatcgaggcggcggccgcgcggctcggcggcgggcgccagggcaccatgcagctgctcaagctcatcctcacctgggtgcagaaccaccacctccagaagaagcgcccccgcacggcgattgacgacggcgccgcgtcgtcggaccctcagctccccagccccggcgcaaaccccggctacgagttcccctccggtggccaggagatgggctccgccgccgccacatcctggatgccctaccaggccttcacgccgccagccgcgtacggcggcgacgccatgtacccaggcgccgccggcccgttccctttccagcagagctgcagcaagagcagcgtggtcgtgagcagccagccgttctccccgccgaccgcggcggcggcgggcgacatgcatgcgtcgggcggagggaacatggcctggccgcagcaattcgcgccgttccccgtctcctccacgagctcctacaccatgccgtcggtcgtgccaccgccgttcaccgccggattccccgggcagtactccggcggccacgccatgtgctctccacgcctcgccggagtcgagccgtcctcgacaaaggaggcccggaagaagcggatggcgaggcagcgccgcctctcctgcctgcagcagcaacgtagccagcagctcaacctgagccagatccacatctccggccatccacaggagccctcccctcgcgccgcgcactcggcgccggtcaccccgtcgtcggccggctgccggagctggggcatctggccgccggcggcccagatcatccagaatcccctatcaaacaagcccaatcctcctcccgccacgtcgaagcagccgaaaccctcgccggagaaaccgaagccgaagccgcaggcggcggcgacggccggagcggagagccttcagcgctcgacggcttcagagaagcggcaggcgaagacggacaagaacctgcggttcctgctgcagaaggtgctgaagcagagcgacgtcgggagcctcggccgcatcgtgctccccaaagaagcagaggttcacctgccggagctgaagacgagggatggtgtctccatccccatggaagacatcgggacgtctcaggtgtggaacatgcggtaccggttttggcccaacaacaaaagcaggatgtatcttctcgaaaacacaggtgattttgttcgttcaaacgagctgcaggagggtgatttcattgtgatctactccgatatcaagtcaggcaaatatctgatacgtggtgtgaaggtgaggcgcgcggcgcaggagcaaggcaactcgtcgggggcggtaggtaagcataagcatggctcgccggagaaacccggcgtctcgtccaatacaaaggccgccggcgccgaggacggcaccggcggcgatgacagtgccgaagccgcagcggcggcggcggcaggcaaggctgacggcggcggctgcaagggcaagtccccgcacggcgtgcggcgttctcgccaggaggccgccgccgccgcctccatgagccagatggcggttagcatctga</cdnaseq>|
 
AA = <aaseq>MDASAGSSAPAAEIRGEAARDDVFFADDTFPLLPDFPCLSSPSS                    STFSSSSSSNSSSAFTTAAGGGCGGEPSEPASAADGFGELADIDQLLDLASLSVPWEA                    EQPLFPDDVGMMIEDAMSGQPHQADDCTGDGDTKAVMEAAGGGDDAGDACMEGSDAPD                    DLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQ                    NHHLQKKRPRTAIDDGAASSDPQLPSPGANPGYEFPSGGQEMGSAAATSWMPYQAFTP                    PAAYGGDAMYPGAAGPFPFQQSCSKSSVVVSSQPFSPPTAAAAGDMHASGGGNMAWPQ                    QFAPFPVSSTSSYTMPSVVPPPFTAGFPGQYSGGHAMCSPRLAGVEPSSTKEARKKRM                    ARQRRLSCLQQQRSQQLNLSQIHISGHPQEPSPRAAHSAPVTPSSAGCRSWGIWPPAA                    QIIQNPLSNKPNPPPATSKQPKPSPEKPKPKPQAAATAGAESLQRSTASEKRQAKTDK                    NLRFLLQKVLKQSDVGSLGRIVLPKEAEVHLPELKTRDGVSIPMEDIGTSQVWNMRYR                    FWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDIKSGKYLIRGVKVRRAAQEQGNS                    SGAVGKHKHGSPEKPGVSSNTKAAGAEDGTGGDDSAEAAAAAAAGKADGGGCKGKSPH                    GVRRSRQEAAAAASMSQMAVSI</aaseq>|
 
DNA = <dnaseqindica>3228..3521#2912..2988#2746..2792#2194..2291#1884..1973#206..1688#111..136#ctcagtaactgcacccacctccacacctacacgcacacagacaaacaaagccaaaccccccgcctcgcctacatctcgcgctctccgccccccgcccgcctccactctgcatggacgcctccgccggctcgtcggcgccgcactcgcacgggaacccggggaagcagggtggcggcggcggcggcggcggcggacgggggaaggccccggcggcggagatcaggggtgaggcggcgagggatgacgtctttttcgctgacgataccttcccgttgctcccggacttcccgtgcctttcttccccgtcaagctcaaccttctcgtcgtcgtcgtcgtcgaactcgtccagcgctttcaccaccgcggcgggagggggttgcggcggtgagccgtccgagccggcctcggcggcggacgggtttggtgagctcgccgacatagaccagctcctcgacctcgcgtcgctgtccgtcccgtgggaggccgagcagccgctgttcccggacgacgttggcatgatgatagaggacgccatgtccgggcaaccgcatcaggcggacgactgtaccggcgacggcgatacgaaggcggtgatggaggcggccgggggaggagacgacgccggcgacgcatgcatggaggggagtgatgcgcccgacgatctgccggcgttcttcatggagtggctcacgagcaaccgtgagtacatctccgccgacgacctccgcagcatccgcctccgccgatccaccatcgaggcggcggccgcgcggctcggcggcgggcgccagggcaccatgcagctgctcaagctcatcctcacctgggtgcagaaccaccacctccagaagaagcgcccccgcacggcgattgacgacggcgccgcgtcgtcggaccctcagctccccagccccggcgcaaaccccggctacgagttcccctccggtggccaggagatgggctccgccgccgccacatcctggatgccctaccaggccttcacgccgccagccgcgtacggcggcgacgccatgtacccaggcgccgccggcccgttccctttccagcagagctgcagcaagagcagcgtggtcgtgagcagccagccgttctccccgccgaccgcggcggcggcgggcgacatgcatgcgtcgggcggagggaacatggcctggccgcagcaattcgcgccgttccccgtctcctccacgagctcctacaccatgccgtcggtcgtgccaccgccgttcaccgccggattccccgggcagtactccggcggccacgccatgtgctctccacgcctcgccggagtcgagccgtcctcgacaaaggaggcccggaagaagcggatggcgaggcagcgccgcctctcctgcctgcagcagcaacgtagccagcagctcaacctgagccagatccacatctccggccatccacaggagccctcccctcgcgccgcgcactcggcgccggtcaccccgtcgtcggccggctgccggagctggggcatctggccgccggcggcccagatcatccagaatcccctatcaaacaagcccaatcctcctcccgccacgtcgaagcagccgaaaccctcgccggagaaaccgaagccgaagccgcaggcggcggcgacggccggagcggagagccttcagcgctcgacggcttcagagaagcggcaggtgtgcatgcatgcagacgattgacatcaatcgctatccaccatagctaggatctcacgcgagtgagaactcgattctcctcctcacacacactccacacactcaaaactcactcactcacatcgctgtccagggatagaatctccaatatttatcaacctagctaattaaacggcatcgattggattgctgcaggcgaagacggacaagaacctgcggttcctgctgcagaaggtgctgaagcagagcgacgtcgggagcctcggccgcatcgtgctccccaaagtgagacagtcaccaccatctcgaacaccttctccttccaaatccactaccccacttggcacaaatccattccatggaaggatcccacttgcacacactcacatacttgatgtttctcccctaatcaaagacggaatttgcctgaaccttctcttcacatttccgatcatggtagaactaaaaagtctcccctttcttgatctgtggatggtttcagaaggaagcagaggttcacctgccggagctgaagacgagggatggtgtctccatccccatggaagacatcgggacgtctcaggtgtggaacatgcggtaccggtgagtaatcaacattcgatcgaagcatcaagcatgatttgggattgcttattaagcttgtttaagtccacttgcttctttgttaattgggaggggatagaaacctctgaaccagaaatagtaaatgactatgggatggtccctttcccaattgggcaagtgggtcatacgaacatatcattggaatctgggagtcaaataggagcatgcattcatcgtgttctatgttgatgctcaagtgcatacaacaaaaaaataaaagtgatcttttcctgctgttttcagtactaacattatgcatatgatttttgctggttctgctgagctcatgtttttgattaattaatttaattatttccattggcaatattatatatgcacaagttattcgaatacatgatggcttagattttgattcactgacattaatggatattgattttcatgaacacaggttttggcccaacaacaaaagcaggatgtatcttctcgaaaacacaggtgaatagcaaacttttgaattattcaaattttacagtcacaagccatgccaataacttccatccttaatttgtggctctcaagtattgttgattaatcgttgtcatatgttttttcaggtgattttgttcgttcaaacgagctgcaggagggtgatttcattgtgatctactccgatatcaagtcaggcaaatatgtaatgttcatccatcattgcccttcccacttctttcgagtactctttaactcaactcagttggatgtgattttgagtgccaataagctatatatagttgctgcatgccactgtttgtctttaattcggatgaccagtttggcagtatctttgtttatggagtacttctgttaatttctgcaagcagcagctaattaattattaaccgtaatcttaatttatctcttaattattagcagctgatacgtggtgtgaaggtgaggcgcgcggcgcaggagcaaggcaactcgtcgggggcggtaggtaagcataagcatggctcgccggagaaacccggcgtctcgtccaatacaaaggccgccggcgccgaggacggcaccggcggcgatgacagtgccgaagccgcagcggcggcggcggcaggcaaggctgacggcggcggctgcaagggcaagtccccgcacggcgtgcggcgttctcgccaggaggccgccgccgccgcctccatgagccagatggcggttagcatctgaagaaacagatgacagcagcagcagcaagcttcagtccatttgaaggttaattattagctagctagctccgtattataaccgatggtaaaacctcctaaaaaaattaattaagttgtgcatgtgaatcgtagcgctagctagggatgatatttgatcagtaacccgtagtccccgtaccagtgacgcttaagtacgcatggtttggttgttcatcgttgaacccctgtagtgtgtcgtcgtcctgtacatgcatcgaattatggaattaattaattacc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051697.2 RefSeq:Os01g0911700]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 05:06, 14 May 2015

Please input one-sentence summary here.

Annotated Information

The expression of OSVP1 could be detected in embryos as early as 2–3 d after pollination (DAP) and thereafter became preferentially localized to shoot, radicle and vascular tissues during the embryo development at both the mRNA and protein levels.

Function

During the mid- to late phase of seed development, the embryo and the aleurone tissue undergo a maturation process, whereby each becomes dormant or quiescent and acquires the ability to tolerate desiccation. The maturation process is associated with the accumulation of characteristic sets of mRNAs and proteins, which are products of the so-called LEA (Late Embryogenesis Abundant protein) genes (Baker et al. 1988, Skriver and Mundy 1990). The phytohormone ABA plays key roles in the control of these events (McCarty 1995, Leung and Giraudat 1998). Genetic loci have been identified in Arabidopsis and maize that are required for the control of maturation processes. The viviparous1 (vp1) mutant of maize has been characterized as an ABA-insensitive mutant, in which various events during seed maturation are blocked (McCarty et al. 1991, Robichaud et al. 1980). At the molecular level, the vp1 mutant fails to accumulate mRNAs of ABA-regulated LEA genes, such as Rab28 (Pla et al. 1989) and the maize homologue of the wheat Em gene (McCarty et al. 1991), as well as the genes for globulin storage proteins (Kriz et al. 1990). The Vp1 gene encodes a transcription factor that can activate the transcription of maturation-associated genes(McCarty et al. 1991, Hattori et al. 1992). In Arabidopsis, ABI3, one of the genes required for ABA response in seeds is known to be orthologous to maize VP1 (Giraudat et al. 1992). Mutant seeds with severe abi3 alleles show vivipary and block the expression of LEA and storage protein genes (Parcy et al. 1994). Parcy et al. (1994) have shown that transgenic Arabidopsis ectopically expressing ABI3 can induce expression of seed-specific genes in non-seed tissues in response to ABA. Thus, VP1/ABI3 is considered to function in determining the seed specificity of certain sets of ABA-regulated genes. Homologues of VP1/ABI3 have also been cloned from several plant species such as tobacco (Phillips and Conrad 1994), bean (Bobb et al. 1995), and wild oat Avena fauta (Jones et al. 1997). We have cloned the rice orthologue of VP1 (OSVP1) and have been studying the mechanism of tissue/organ-specific regulation of ABA-responsive genes such as the rice Em (OSEM) gene, in which OSVP1 is expected to play a key role (Hattori et al. 1994, Hattori et al. 1995). VP1/ABI3 functions as a transcription factor by acting on at least two distinct types of cis-elements, namely, ABA-response elements (ABREs) and RY/Sph elements. While VP1/ABI3 acts on ABREs via the interaction with ABRE-binding factors such as TRAB1 and ABI5 (Hobo et al. 1999a, Finkelstein and Lynch 2000, Lopez-Molina and Chua 2000, Nakamura et al. 2001), it directly binds to the RY/Sph element through its own DNA binding domain called the B3-domain (Suzuki et al. 1997).

Expression

Fig.1.jpg
Fig.2.jpg

Temporal and spatial regulation of OSVP1 expression during embryo development[1] Temporal and spatial patterns of OSVP1 expression, at both the mRNA and protein level, were examined by in situ hybridization and immuno-localization analyses. OSVP1 mRNA was not detected in the embryo at 1 DAP (Fig. 1A), but was expressed in the whole embryo by 2 DAP (Fig. 1B). Examination of multiple sections from independent seeds revealed that OSVP1 mRNA became detectable in the embryos of 50–70 µm in length, which corresponded to the mid-globular stage. Until 4 DAP, when the coleoptiles started to differentiate, OSVP1 mRNA was distributed uniformly throughout the embryo (Fig. 1B–D). At 6 DAP, however, the signals became localized to those regions where the shoot and radicle were developing (Fig. 1E). A clearer distribution of OSVP1 mRNA could be observed when all the embryonic organs were fully established (Fig. 1F–H). OSVP1 mRNA could be detected in the vascular tissues, a part of coleoptiles, leaves, shoot meristem, and radicle. Epidermal layers of the scutellum and epiblast also showed stronger signals than the inner tissues of these organs. Although other parts of the embryo appeared to express lower levels of OSVP1, it was not certain whether those signals were above the non-specific background. Overall levels of OSVP1 mRNA appeared to decrease by the mature 20 DAP stage (Fig. 1H) compared to those at 10–15 DAP (Fig. 1F, G). In the endosperm, OSVP1 mRNA was detected only in the aleurone layers, the outermost cell layers, after 6 DAP when they had just differentiated, but not in the inner tissues (Fig. 2A–D). Spatial distribution of OSVP1 protein during development of the embryo was also examined using antibody against OSVP1. The localization of OSVP1 protein was essentially the same as that of the mRNA throughout embryogenesis (Fig. 3). OSVP1 protein was also detected in the aleurone layers (Fig. 2E–H). In Fig. 3, the protein was first detected at 3 DAP but not at 2 DAP. Although there was a 1-d difference in the earliest time the mRNA and protein could be detected, the actual difference in the developmental stage may be much smaller considering the size of the globular embryo. Examination at higher magnification revealed that signals of OSVP1 protein could be found in the nuclei irrespective of the developmental stages (Fig. 3, 4). This observation provides an additional piece of evidence that (OS)VP1 is a transcription factor. In the radicle, the protein was localized in the meristem, epidermis, central stele and the outer cells, but not in the inner cells of the cortex (Fig. 4A). In contrast to the highly tissue-specific localization of OSVP1 detected in the radicle, the shoot apex exhibited quite uniform expression (Fig. 4). The overall expression pattern of OSVP1 mRNA and protein at the later stages appeared to be localized to those organs and tissues that are still undergoing development or play a vital role in the germination and post-germination phases.

Fig.3.jpg
Fig.4.jpg

OsVP1 1improves the tolerance of rice crops against drought and salt by employing multiple strategies in addition to osmotic regulation.[2] To test the effects of double overexpression by both genes on salt tolerance by transgenic rice, we studied 2-week-old seedlings from homozygous lines ofOsVP1 and OsNHX1 as well as DO plants from F2. After treatment with 100 mM NaCl for 3 weeks, WT plants showed leaf chlorosis and gradually died, while plants overexpressing OsVP1, OsNHX1, or both had enhanced tolerance .Respective survival rates for theOsVP1-OE, OsNHX1-OE, and DO lines were 85.33%, 100%, and 100%, all of which were significantly higher than the 38.67% recorded from the WT. Seedling heights, root lengths, and fresh weights were also significantly greater for the transformed lines (Table 1and Fig.3b). Finally, Na+ concentrations in leaves were lower in the transgenics than in the WT (Fig.3c). Relative water content is an indicator of leaf water status. When WT plants were grown with 100 mM NaCl for 1 week, their RWC values decreased 12%, whereas no significant differences were found among OsVP1-OE, OsNHX1-OE, and DO plants when grown under either normal or high-salt conditions (Fig. 3d). Such treatment also induced a greater accumulation of proline in transgenic plants (Table1). Because proline can potentially lead to osmotic adjustments, it seems that the transgenic plants were able to drive the uptake of additional water by accumulating more soluble substance. To investigate the degree of membrane peroxidation and changes in photosynthesis, we measured MDA contents and net photosynthetic rates under either normal or high-salt conditions. Whereas exposure to excess NaCl increased MDA values in both transgenic and WT plants, those measured from OsNHX1-OE and DO (except OsVP1transformants) were significantly lower (Table1). This suggested that overexpression ofOsNHX1 alleviated salt-induced damage to the membrane system. Under such stress,Pnwas significantly diminished in the WT, whereas that rate was maintained at a near-normal level in the transgenics (Table 1). This indicated that overexpression ofOsVP1, OsNHX1, or both could protect the photosynthesis apparatus of rice plants from salt damage. After 2 weeks of water-deficit treatment, the leaves of WT seedlings grown at 20% MWC were wilted (Fig. 4a), whereasOsVP1-OE and DO plants exhibited less damage, as defined by their wilting status (Fig.4b). Further analysis revealed that RWC values were higher in OsVP1-OE and DO leaves than in the WT (Fig.4d). These results suggested that OsVP1could enhance drought tolerance in overexpressing transgenic plants. When plants are exposed to a moisture deficit, leaf water potential decreases, with the extent of that reduction being reflected by their ability to acquire water from their surroundings. Under normal conditions, we found no significant difference in leaf water potential between transgenic and WT plants. However, that parameter was down-regulated inOsVP1and DO plants under drought stress (Fig.4c), suggesting that this osmotic adjustment was triggered by overexpression of OsVP1.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo, 113-8657 Japan

Center for Molecular Biology and Genetics, Mie University, Tsu, 514-8507 Japan

Center for Molecular Biology and Genetics,Mie University,1515 Kamihama-cho,Tsu,514 Japan

State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058, People’s Republic of China

References

[1]

Structured Information

  1. Kazumaru Miyoshi, Yasuaki Kagaya, Yuichirou Ogawa,et al.(2002)Temporal and Spatial Expression Pattern of the OSVP1 and OSEM Genes during Seed Development in Rice. Plant and Cell Physiology.Volume 43: 307-313.