Difference between revisions of "Os01g0968800"

From RiceWiki
Jump to: navigation, search
 
(10 intermediate revisions by one other user not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Dimerization is one of the most distinct characteristics of TFs, OsDREB1F was indicates that can form homodimeric complex by using two-hybrid system. So OsDREB1F was a transactivator, and the transactivation domain located in the C-terminal of OsDREB1F as well. It plays a key role in plant stress signalling transduction pathway which can specifically bind to DRE/CRT element (G/ACCGAC) and activate the expression of many stress inducible genes. Additionaly,OsDREB1F localizes in nucleus.
 +
 
 +
OsDREB1F gene would induced by salt,drought, cold stresses, and also ABA application, but not by pathogen, wound, and H2O2<ref name="ref1"/>.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File: tissue.png|right|thumb|150px|''The organ-specific expression of OsDREB1F. 1 to 6 represents the young roots, young leaves,mature roots, mature leaves, spike and the callus, respectively. (from reference <ref name="ref1" />).'']]
 +
 
 +
[[File: condition.png|right|thumb|150px|''OsDREB1F expression patterns in response to various treatments (from reference <ref name="ref1" />).'']]
 +
 
 +
OsDREB1F was constitutively expressed in almost all the tissues and organs examined, including the young leaves, young roots, mature leaves, mature roots, young panicles and callus, and the expression is higher in panicles and callus than in the other tissues. <ref name="ref1"/>
 +
 
 +
Overexpression of OsDREB1F in plants can greatly enhanced tolerance of plants to high salinity, drought, and low-temperature both in rice and Arabidopsis<ref name="ref1"/>.
 +
 
 +
DREB TFs are able to activate the expression of COR genes which contain DRE/CRT element in their upstream promoter regions.And overexpression of OsDREB1F led to activate the expression of both ABA-dependent and ABA-independent genes<ref name="ref1"/>.
 +
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File: OsDREB1F evolution.png|right|thumb|150px|''The comparison of OsDREB1F and other AP2/EREBP proteins (from reference <ref name="ref1" />).'']]
 +
 
 +
 
 +
DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element  binding  proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, ERFs and DREBs/CBFs. ERFs bind to the GCCbox found in the promoters of many pathogenesis-related (PR) genes conferring ethylene responsiveness, while DREBs/CBFs bind to the dehydration responsive element (DRE/CRT) in the promoters of cold and dehydration responsive LEA genes including rd29A, rd17, cor6.6, cor15a, erd10 and kin1. The DREBs/CBFs are further divided into two subclasses, DREB1/CBF and DREB2, induced by cold and dehydration stress respectively<ref name="ref3"/>.
 +
 
 +
OsDREB1F was homologous to DREB or DREB-like TFs from other plants<ref name="ref1"/>. Colinearity analysis ofDREB1s from rice and Arabidopsis showed that each of the rice homologs possessed colinearity to Arabidopsis DREB1s to some extent<ref name="ref2"/>.
  
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*State Key Laboratory of Plant Genomics and National Centre for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese    Academy of Sciences (CAS)
 +
*Key Laboratory of Agro-Ecological Processes in Subtropical Region, Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha,China
 +
*University of tsukuba, Gene Research center, tsukuba, Japan
 +
*Khyber Pakhtunkhwa Agricultural University Peshawar, institute of Biotechnology and Genetic engineering (iBGe), Pakistan
  
 
==References==
 
==References==
 +
<references>
 +
<ref name="ref1">Qiuyun Wang,Yucheng Guan,Yaorong Wu,Honglin Chen,Fan Chen,Chengcai Chu.(2008) Overexpression of a rice OsDREB1F gene increases salt, drought, and low temperature tolerance in both Arabidopsis and rice,Plant Molecular Biology, 67(6):589-602.</ref>
 +
<ref name="ref2">Donghai Mao,Caiyan Chen.(2012) Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway,PLoS ONE,7(10): e47275.</ref>
 +
<ref name="ref3">Mohammad Sayyar Khan.(2011)THE ROLE OF DREB TRANSCRIPTION FACTORS IN ABIOTIC STRESS TOLERANCE OF PLANTS,Biotechnol.2433-2442</ref>
 +
</references>
  
1. Donghai Mao;Caiyan Chen, Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway
+
PLoS ONE, 2012, 7(10): e47275
 
2. Qiuyun Wang;Yucheng Guan;Yaorong Wu;Honglin Chen;Fan Chen;Chengcai Chu, Overexpression of a rice OsDREB1F gene increases salt, drought, and low temperature    tolerance in both Arabidopsis and rice,Plant Molecular Biology, 2008, 67(6): 589-602
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0968800|
 
Description = Similar to Dehydration responsive element binding protein 1F (DREB1F protein)|
 
Version = NM_001052056.1 GI:115442482 GeneID:4323832|
 
Length = 840 bp|
 
Definition = Oryza sativa Japonica Group Os01g0968800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:44522272..44523111|
 
CDS = 44522341..44523000|
 
GCID = <gbrowseImage1>
 
name=NC_008394:44522272..44523111
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:44522272..44523111
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggacaccgaggacacgtcgtcggcttcgtcctcgtcggtgtcgccgccgtcgtcgccgggcggcgggcaccaccaccggctgccgccgaagcggcgggcggggcggaagaaattccgggagacgcggcacccggtgtaccgcggcgtgcgcgcgcgggcgggggggagcaggtgggtgtgcgaggtgcgcgagccgcaggcgcaggcgcgcatctggctcggcacctacccgacgccggagatggcggcgcgcgcgcacgacgtcgcggccatcgccctccgcggcgagcgcggcgccgagctcaacttcccggactccccctccacgctcccgcgcgcgcgcacggcgtcgcccgaggacatccgcctcgccgccgcgcaggccgccgagctgtaccgccgcccgccgccgccgctggcattgccggaggatccgcaggaaggcacgagcggcggcggcgccaccgccacctcggggcgtccggctgccgtgttcgtggacgaggacgccatcttcgacatgccggggctgatcgacgacatggcgagggggatgatgctgacgccgccggcgattgggagatctctcgacgactgggccgccatcgacgacgacgatgaccattaccacatggactacaagctatggatggactga</cdnaseq>|
 
AA = <aaseq>MDTEDTSSASSSSVSPPSSPGGGHHHRLPPKRRAGRKKFRETRH                    PVYRGVRARAGGSRWVCEVREPQAQARIWLGTYPTPEMAARAHDVAAIALRGERGAEL                    NFPDSPSTLPRARTASPEDIRLAAAQAAELYRRPPPPLALPEDPQEGTSGGGATATSG                    RPAAVFVDEDAIFDMPGLIDDMARGMMLTPPAIGRSLDDWAAIDDDDDHYHMDYKLWM                    D</aaseq>|
 
DNA = <dnaseqindica>70..729#ccctcctctcatcgcaccaccacgccactgagctcaagctaagctaagtgctaacctaggtgttcgaccatggacaccgaggacacgtcgtcggcttcgtcctcgtcggtgtcgccgccgtcgtcgccgggcggcgggcaccaccaccggctgccgccgaagcggcgggcggggcggaagaaattccgggagacgcggcacccggtgtaccgcggcgtgcgcgcgcgggcgggggggagcaggtgggtgtgcgaggtgcgcgagccgcaggcgcaggcgcgcatctggctcggcacctacccgacgccggagatggcggcgcgcgcgcacgacgtcgcggccatcgccctccgcggcgagcgcggcgccgagctcaacttcccggactccccctccacgctcccgcgcgcgcgcacggcgtcgcccgaggacatccgcctcgccgccgcgcaggccgccgagctgtaccgccgcccgccgccgccgctggcattgccggaggatccgcaggaaggcacgagcggcggcggcgccaccgccacctcggggcgtccggctgccgtgttcgtggacgaggacgccatcttcgacatgccggggctgatcgacgacatggcgagggggatgatgctgacgccgccggcgattgggagatctctcgacgactgggccgccatcgacgacgacgatgaccattaccacatggactacaagctatggatggactgacatgtatacacacatatcgttcgagtatatatgcttacagatatagataatactccatcagttcctactaaatacggagtatatatttttagataaaggatttatataaaa</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052056.1 RefSeq:Os01g0968800]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 05:09, 14 May 2015

OsDREB1F is a rice DREB transcription factor,which participates in rice responses to both abiotic and biotic stresses.

Annotated Information

Function

Dimerization is one of the most distinct characteristics of TFs, OsDREB1F was indicates that can form homodimeric complex by using two-hybrid system. So OsDREB1F was a transactivator, and the transactivation domain located in the C-terminal of OsDREB1F as well. It plays a key role in plant stress signalling transduction pathway which can specifically bind to DRE/CRT element (G/ACCGAC) and activate the expression of many stress inducible genes. Additionaly,OsDREB1F localizes in nucleus.

OsDREB1F gene would induced by salt,drought, cold stresses, and also ABA application, but not by pathogen, wound, and H2O2[1].

Expression

The organ-specific expression of OsDREB1F. 1 to 6 represents the young roots, young leaves,mature roots, mature leaves, spike and the callus, respectively. (from reference [1]).
OsDREB1F expression patterns in response to various treatments (from reference [1]).

OsDREB1F was constitutively expressed in almost all the tissues and organs examined, including the young leaves, young roots, mature leaves, mature roots, young panicles and callus, and the expression is higher in panicles and callus than in the other tissues. [1]

Overexpression of OsDREB1F in plants can greatly enhanced tolerance of plants to high salinity, drought, and low-temperature both in rice and Arabidopsis[1].

DREB TFs are able to activate the expression of COR genes which contain DRE/CRT element in their upstream promoter regions.And overexpression of OsDREB1F led to activate the expression of both ABA-dependent and ABA-independent genes[1].


Evolution

The comparison of OsDREB1F and other AP2/EREBP proteins (from reference [1]).


DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element binding proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, ERFs and DREBs/CBFs. ERFs bind to the GCCbox found in the promoters of many pathogenesis-related (PR) genes conferring ethylene responsiveness, while DREBs/CBFs bind to the dehydration responsive element (DRE/CRT) in the promoters of cold and dehydration responsive LEA genes including rd29A, rd17, cor6.6, cor15a, erd10 and kin1. The DREBs/CBFs are further divided into two subclasses, DREB1/CBF and DREB2, induced by cold and dehydration stress respectively[2].

OsDREB1F was homologous to DREB or DREB-like TFs from other plants[1]. Colinearity analysis ofDREB1s from rice and Arabidopsis showed that each of the rice homologs possessed colinearity to Arabidopsis DREB1s to some extent[3].


Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Centre for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences (CAS)
  • Key Laboratory of Agro-Ecological Processes in Subtropical Region, Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha,China
  • University of tsukuba, Gene Research center, tsukuba, Japan
  • Khyber Pakhtunkhwa Agricultural University Peshawar, institute of Biotechnology and Genetic engineering (iBGe), Pakistan

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Qiuyun Wang,Yucheng Guan,Yaorong Wu,Honglin Chen,Fan Chen,Chengcai Chu.(2008) Overexpression of a rice OsDREB1F gene increases salt, drought, and low temperature tolerance in both Arabidopsis and rice,Plant Molecular Biology, 67(6):589-602.
  2. Mohammad Sayyar Khan.(2011)THE ROLE OF DREB TRANSCRIPTION FACTORS IN ABIOTIC STRESS TOLERANCE OF PLANTS,Biotechnol.2433-2442
  3. Donghai Mao,Caiyan Chen.(2012) Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway,PLoS ONE,7(10): e47275.


Structured Information