Difference between revisions of "Os02g0126400"

From RiceWiki
Jump to: navigation, search
(Structured Information)
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The ''OsCPK4'' gene is a member of the complex gene family of calcium-dependent protein kinases in rice (''Oryza sativa''), and its overexpression confers salt and drought tolerance by preventing membrane lipid peroxidation<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*The ''OsCPK4'' gene (''Os02g0126400'') encodes a CDPK containing the four-domain structure typical of CDPKs: an N-terminal variable domain, a Ser/Thr kinase domain, a junction autoinhibitory domain, and a C-terminal calmodulin domain<ref name="ref1"/> (Fig. 1A).The protective effects of ''OsCPK4'' overexpression in conferring salt and drought tolerance might rely more on the protection against oxidative damage of membranes and the activation of genes involved in lipid metabolismrather than on the activation of the typical salt/drought stressassociated transcriptional networks in root tissues<ref name="ref1"/>.
 +
*''OsCPK4'' functions as a positive regulator of the salt and drought stress responses in rice via the protection of cellular membranes from stress-induced oxidative damage. The protective effects of ''OsCPK4'' overexpression in conferring salt and drought tolerance might rely more on the protection against oxidative damage of membranes and the activation of genes involved in lipid metabolismrather than on the activation of the typical salt/drought stressassociated transcriptional networks in root tissues<ref name="ref1"/>
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672], [http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0005509 GO:0005509], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468]
 +
 
 +
===Mutation===
 +
*loss-of-function mutants: two transfer DNA (T-DNA) insertion mutants of ''OsCPK4''<ref name="ref1"/>:<br>
 +
To further investigate the function of ''OsCPK4'', ''Campo et al.'' searched for loss-of-function mutants. Two transfer DNA (T-DNA) insertion mutants of ''OsCPK4'' were identified in the POSTECH collection: 2D-00040 (cv Dongjin background) and 1D-03351 (cv Hwayoung background). Both of them contained the T-DNA insertion in the kinase domain of the ''OsCPK4'' gene.
 +
 
 +
*In each experiment<ref name="ref1"/>:
 +
**wild-type (WT)
 +
**vector control(pC; three independent lines)
 +
**''OsCPK4'' overexpressor (OsCPK4-OX; five independent lines)
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File: OsCPK4 Expression.jpg|left|thumb|250px|'''Figure 1.''' Expression of OsCPK4 in response to salt and drought stress.(from reference <ref name="ref1"/>).'']]
 +
*''OsCPK4'' gene expression is induced by salt and drought stress. ''OsCPK4'' and ''OsLEA23/OsDip1'' share similar expression patterns in response to salt stress, these two genes representing early salt stressresponsive genes<ref name="ref1"/>:<br>
 +
''OsCPK4'' was rapidly and transiently activated upon exposure to salt stress in rice roots (Fig. 1C, left). Under drought stress imposed by either air-drying treatment or polyethylene glycol (PEG) treatment, induction of ''OsCPK4'' expression was also observed, its activation being maintained during the entire period of stress treatment (Fig. 1C, middle and right). To assess the effectiveness of treatment, ''Campo et al.'' analyzed the expression of the marker gene ''OsLEA23''<ref name="ref2"/>, a dehydrin gene also known as ''OsDip1'' (Fig. 1D). The expression of ''OsLEA23/OsDip1'' is known to be up-regulated by salt and drought stress<ref name="ref2"/> (earlyresponsive gene). ''OsLEA23/OsDip1'' transcripts increased in response to high-salt conditions, with the highest levels recorded at 1 h of salt treatment and then decreasing at subsequent times of salt treatment (Fig. 1D, left). Air-drying and PEG treatment also induced ''OsLEA23/OsDip1'' expression (Fig. 1D, middle and right).
 +
*''OsCPK4'' expression is induced in response to treatment with ABA, the transcriptional activation of ''OsCPK4'' expression in response to salt and drought stress or ABA treatment is accompanied by the accumulation of the ''OsCPK4'' protein in rice roots.
 +
''OsCPK4'' overexpression confers tolerance to salt and drought stress in rice plants.
 +
''OsCPK4'' knockout results in severe growth inhibition, which suggesting  ''OsCPK4'' disruption has a strong impact on plant growth, ''OsCPK4''being required for the normal growth and development of rice plants<ref name="ref1"/>.
 +
 
 +
*Overexpression of ''OsCPK4'' results in few transcriptional changes in either root or leaf tissues. In root tissues, ''OsCPK4'' positively regulates the expression of genes involved in metabolic processes, mainly lipid metabolism, as well as genes involved in
 +
protection against oxidative stress. No significant alterations in the expression of salt-associated genes appear to occur in roots of ''OsCPK4'' rice plants, whereas a reduction in the expression of certain salt-associated genes occurs in leaves of ''OsCPK4'' plants<ref name="ref1"/>.
 +
*''OsCPK4'' overexpression prevents salt stress-induced lipid peroxidation and electrolyte leakage in cellular membranes under salt stress conditions. Under salt stress conditions, the ''OsCPK4'' transgenic plants accumulate less Na+ in their roots than control plants<ref name="ref1"/>.
 +
 
 +
===Subcellular localization===
 +
To localize ''OsCPK4'' in the plant cell, ''Campo et al.'' transiently expressed an OsCPK4-GFP fusion gene in onion epidermal cells: A plasma membrane localization of ''OsCPK4'' was observed by transient expression assays of green fluorescent protein-tagged ''OsCPK4'' in onion (''Allium cepa'') epidermal cells<ref name="ref1"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File: OsCPK21 Phylogenetic1.jpg|left|thumb|250px|'''Figure 2.'''''Phylogenetic relationships between CDPKs from rice and Arabidopsis.(from reference <ref name="ref3"/>).'']]
 +
[[File: OsCPK21 Phylogenetic2.jpg|right|thumb|250px|'''Figure 3.Phylogenetic relatedness among the rice, Arabidopsis and functionally characterized CDPKs from other plant species.(from reference <ref name="ref4"/>).'']] 
 +
[[File: OsCPK21 Phylogenetic3.jpg|left|thumb|250px|'''Figure 4.'''''Phylogenetic relationships among CDPKs from rice (OsCPK1-OsCPK29)
 +
and Arabidopsis (AtCPK1-AtCPK34).(from reference <ref name="ref6"/>).'']] 
 +
[[File: OsCPK21 Phylogenetic4.jpg|right|thumb|250px|'''Figure 5.Phylogenetic relationships among rice CCaMK, and rice and Arabidopsis CDPKs, CRKs and PEPRKs.(from reference <ref name="ref5"/>).'']] 
 +
 
 +
*The phylogenetic tree was created using the ClustalW program based on the alignment of the kinase catalytic domains of 29 rice (''OsCPK1''-''OsCPK29'') and 34 ''Arabidopsis'' (''AtCPK1''-''AtCPK34'') CDPKs. ''OsCPK21''<ref name="ref3"/> is indicated by an arrow. Phylogenetic analysis showed that rice CDPKs are divided into four distinct classes, ''OsCPK4'' belongs to the Group IV <ref name="ref1"/><ref name="ref3"/>(Fig. 2).
 +
 
 +
*To study the evolutionary relatedness of rice and ''Arabidopsis'' CDPKs with all the CDPK genes characterized so far from alfalfa, cucumber, ice plant, mung bean, potato, strawberry, tomato, ''Petunia'', maize, tobacco and ''Medicago'', an unrooted tree was constructed by using ClustalX 1.83. This exercise resulted in four distinct groups similar to that reported by ''Asano et al.''<ref name="ref4"/><ref name="ref5"/>(Fig. 3).
 +
 
 +
*The amplitude of difierential expression for these genes was not as significant as reported earlier, possibly due to use of difierent rice variety and/or experimental conditions. Most of the previously identiWed stress responsive CDPK genes cluster together in
 +
subclades Ia and Ib<ref name="ref4"/>(Fig. 3).
 +
 
 +
*Each calcium-dependent protein kinase (CDPK) consists of a variable N-terminal domain, a protein kinase domain, an autoinhibitory region and a calmodulin-like domain with EFhand Ca<sup>2+</sup>-binding sites. CDPKs are directly activated by the binding of Ca<sup>2+</sup> to the calmodulin-like domain, and the activated CDPKs regulate downstream targets. CDPKs have been identified throughout the plant kingdom, and in some protozoans, but not in animals. CDPKs constitute a large multigene family in various plant species; CDPK genes have been identified in ''Arabidopsis thaliana'', and CDPK genes have been found in ''Oryza sativa'' (rice)(Fig. 4). The expression and activities of CDPKs are upregulated by a variety of stimuli, such as hormones, abiotic stresses and biotic stresses. Red letters indicate CDPKs involved in abiotic stress signaling<ref name="ref6"/>.
 +
 
 +
*Phylogenetic relationships among rice CCaMK, and rice and ''Arabidopsis'' CDPKs, CRKs and PEPRKs. A phylogenetic tree was created using the ClustalW program, based on the predicted amino acid sequences of the rice and ''Arabidopsis'' kinases, which are indicated by red and blue type, respectively.As shown in Fig. 5, the phylogenetic tree of these kinase sequences forms seven subgroups: CDPKs I–IV, CRKs, CCaMK and PEPRKs. Furthermore, the 29 rice CDPKs were divided into four distinct classes<ref name="ref5"/>.
 +
 
 +
===Knowledge Extension===
 +
[[File: function of CDPKs.jpg|right|thumb|250px|'''Figure 6.Summary of the function of CDPKs in ABA and abiotic stress responses, as reported by several authors(from reference <ref name="ref6"/>).'']] 
 +
In rice, the CDPKs constitute a large family of 29 genes<ref name="ref5"/>.
 +
CDPK genes (''OsCPK1-29'') contain multiple stress-responsive cis-elements in the promoter region (1 kb) upstream of genes. Analysis of the information extracted from the Rice Expression Database indicates that 11 of the CDPK genes are regulated by chilling temperature, dehydration, salt, rice blast infection and chitin treatment. RT-PCR and RNA gel blot hybridization were performed in this study to detect the expression 19 of the CDPK genes. Twelve CDPK genes exhibited cultivar- and tissue-specific expression; four CDPK genes (''OsCPK6'', ''OsCPK13'', ''OsCPK17'' and ''OsCPK25'') were induced by chilling temperature, dehydration and salt stresses in the rice seedlings. While ''OsCPK13'' (''OsCDPK7'') was already known to be inducible by chilling temperature and high salt, this is the first report that the other three genes are stress-regulated. ''OsCPK6'' and ''OsCPK25'' are up-regulated by dehydration and heat shock, respectively, while ''OsCPK17'' is down-regulated by chilling temperature, dehydration and high salt stresses. Based on this evidence, rice CDPK genes may be important components in the signal transduction pathways for stress responses<ref name="ref3"/><ref name="ref7"/>.
  
You can also add sub-section(s) at will.
+
Three major classes of Ca<sup>2+</sup>-binding proteins have been characterized in higher plants: calciumdependent protein kinases (CDPKs), calmodulins (CaMs) and CaM-like proteins, and calcineurin B-like proteins<ref name="ref6"/>.
 +
The subcellular localization of each CDPK and the phenotypes of overexpression (OX) or knockout or knockdown (KO) lines are described. Red letters, ''Arabidopsis'' CDPKs; green letters, rice CDPKs; P, phosphorylation; ABF, ABA-responsive element binding factor; HSP1, a heat shock protein; OST1, open stomata 1 protein kinase<ref name="ref6"/>(Fig. 6).
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Centre for Research in Agricultural Genomics, Consejo Superior de Investigaciones Científicas-Institut de Recerca i Tecnologia Agroalimentàries-Universitat Autònoma de Barcelona-Universitat de Barcelona, Campus UAB, Bellaterra, Cerdanyola del Valles, 08193 Barcelona, Spain (S.C., P.B., J.M., M.C., B.S.S.)
 +
*Oryzon Genomics, Cornella de Llobregat, 08940 Barcelona, Spain (E.L.)
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Campo S, Baldrich P, Messeguer J, et al. Overexpression of a Calcium-dependent protein kinase confers salt and drought tolerance in rice by preventing membrane lipid peroxidation[J]. Plant physiology, 2014, 165(2): 688-704.
 +
</ref>
 +
* <ref name="ref2">
 +
Rabbani M A, Maruyama K, Abe H, et al. Monitoring expression profiles of rice genes under cold, drought, and high-salinity stresses and abscisic acid application using cDNA microarray and RNA gel-blot analyses[J]. Plant physiology, 2003, 133(4): 1755-1767.
 +
</ref>
 +
* <ref name="ref3">
 +
Asano T, Hakata M, Nakamura H, et al. Functional characterisation of OsCPK21, a calcium-dependent protein kinase that confers salt tolerance in rice[J]. Plant molecular biology, 2011, 75(1-2): 179-191.
 +
</ref>
 +
* <ref name="ref4">
 +
Ray S, Agarwal P, Arora R, et al. Expression analysis of calcium-dependent protein kinase gene family during reproductive development and abiotic stress conditions in rice (Oryza sativa L. ssp. indica)[J]. Molecular Genetics and Genomics, 2007, 278(5): 493-505.
 +
</ref>
 +
* <ref name="ref5">
 +
Asano T, Tanaka N, Yang G, et al. Genome-wide identification of the rice calcium-dependent protein kinase and its closely related kinase gene families: comprehensive analysis of the CDPKs gene family in rice[J]. Plant and cell physiology, 2005, 46(2): 356-366.
 +
</ref>
 +
* <ref name="ref6">
 +
Asano T, Hayashi N, Kikuchi S, et al. CDPK-mediated abiotic stress signaling[J]. Plant Signal Behav, 2012, 7(7): 817-821.
 +
</ref>
 +
* <ref name="ref7">
 +
Wan B, Lin Y, Mou T. Expression of rice Ca< sup> 2+</sup>-dependent protein kinases (CDPKs) genes under different environmental stresses[J]. FEBS letters, 2007, 581(6): 1179-1189.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os02g0126400|
 
Description = Similar to Protein kinase CPK1|
 
Version = NM_001052286.1 GI:115443942 GeneID:4328155|
 
Length = 6404 bp|
 
Definition = Oryza sativa Japonica Group Os02g0126400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:1387873..1394276|
 
CDS = 1388049..1388330,1390352..1390482,1390840..1390881,1391027..1391138,1391241..1391319<br>,1391441..1391610,1392503..1392629,1392731..1392846,1392926..1393033<br>,1393118..1393180,1393283..1393456,1393814..1393978|
 
GCID = <gbrowseImage1>
 
name=NC_008395:1387873..1394276
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:1387873..1394276
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgggcgcgtgcttctcatcccacactgcgaccgccgccgccgatggcgggagcgggaagcggcagcagcggaagggggatcacaaggggaagctccccgatggcggcggcggcgagaaggagaaggaggcggcgcgggtggagttcgggtacgagagggacttcgaggggaggtaccaggtcgggaggctgctcggccacggccagttcggctacaccttcgccgccaccgaccgggcctccggtgaccgcgtcgccgtcaagcgcatcgacaaggccaagatggttcgccctgttgctgtggaggatgtaaagagagaagtgaagattcttaaagaacttaaaggccatgagaatattgttcacttctacaatgcgtttgaagatgactcatatgtatatattgtgatggaactatgtgagggtggtgaactattggaccggattttggcaaaaaagaacagccgttatagtgagaaagatgctgcagtggtggtgcggcagatgctcaaagtggcagctgagtgccatctgcatgggctagttcaccgagatatgaagcccgagaacttccttttcaaatcaaccaaggaggactcacctttaaaggcaacagattttggtctgtcagacttcataaaaccagggaaaaagtttcacgatatagttggcagtgcctattatgtagcaccagaagttttaaaacgacggtctggccctgagtcagatgtttggagcataggagtcataacttatattttgctctgtgggagacgccctttttggaataagacagaggatggcatattcagagaggtactaagaaacaagcctgattttcgtaagaagccttggccaggcatcagttcaggtgctaaagatttcgttaaaaagttacttgtaaagaacccaagggcaagattaaccgctgctcaagctctctcgcatccatgggtaagagaaggaggagaagcatctgagatccctgttgatatatctgtattgtccaacatgcgtcagtttgtcaagtacagccgttttaagcaatttgctctgagggctttagcaagtacactaaaagaggaagaactagcagatctgaaggaccagttcgatgcaattgatgttgataaaagtggatcaattagtattgaggaaatgcggcatgcccttgcaaaggatcttccttggagattgaagggcccccgtgttctcgagattatccaagcaatcgacagcaacactgatggtcttgtggactttgaagagtttgtagcagcaaccctccatatacatcaaatggctgagcttgactctgaaaggtggggcctacgctgccaggctgctttcagcaaatttgatctggatggtgacggatacatcactccagatgaactcagaatggtgcagcacactggcttgaagggttccatcgagccattgctggaggaggccgacatcgacaaagacgggagaataagcttgtcggagttccgcaagctcctgcggacagcgagcatgagcaaccttcccagtccaagaggacctccaaatccacaacccctgtga</cdnaseq>|
 
AA = <aaseq>MGACFSSHTATAAADGGSGKRQQRKGDHKGKLPDGGGGEKEKEA                    ARVEFGYERDFEGRYQVGRLLGHGQFGYTFAATDRASGDRVAVKRIDKAKMVRPVAVE                    DVKREVKILKELKGHENIVHFYNAFEDDSYVYIVMELCEGGELLDRILAKKNSRYSEK                    DAAVVVRQMLKVAAECHLHGLVHRDMKPENFLFKSTKEDSPLKATDFGLSDFIKPGKK                    FHDIVGSAYYVAPEVLKRRSGPESDVWSIGVITYILLCGRRPFWNKTEDGIFREVLRN                    KPDFRKKPWPGISSGAKDFVKKLLVKNPRARLTAAQALSHPWVREGGEASEIPVDISV                    LSNMRQFVKYSRFKQFALRALASTLKEEELADLKDQFDAIDVDKSGSISIEEMRHALA                    KDLPWRLKGPRVLEIIQAIDSNTDGLVDFEEFVAATLHIHQMAELDSERWGLRCQAAF                    SKFDLDGDGYITPDELRMVQHTGLKGSIEPLLEEADIDKDGRISLSEFRKLLRTASMS                    NLPSPRGPPNPQPL</aaseq>|
 
DNA = <dnaseqindica>177..458#2480..2610#2968..3009#3155..3266#3369..3447#3569..3738#4631..4757#4859..4974#5054..5161#5246..5308#5411..5584#5942..6106#accttcctctccaccttcctcttcctcccgaccaaacaacctccctcctcctcctccacctcgtcgtcgtctccgccgcgctgtctcctcctctatataccctcacccacactcgcacgcgcaaacccaacccccgcatatgcttaactccccaacccaaaccctcctcctcccccatgggcgcgtgcttctcatcccacactgcgaccgccgccgccgatggcgggagcgggaagcggcagcagcggaagggggatcacaaggggaagctccccgatggcggcggcggcgagaaggagaaggaggcggcgcgggtggagttcgggtacgagagggacttcgaggggaggtaccaggtcgggaggctgctcggccacggccagttcggctacaccttcgccgccaccgaccgggcctccggtgaccgcgtcgccgtcaagcgcatcgacaaggccaaggtactactaatactattactactggactttgacgcttggtctgtgtgattcgctgcggtttcgcgggaattcgggagttccatttcggattgagctagtgcgaattggttttgtttagattgttttctcgaattttgggcgtttagctcaagtaaaattctgattcatcaacgatatttttggttgttttgggtagtttagctgtcggtgaggccctacactacactcctcctaatcatatcatttatcgtttagttggggatttcacctcgttcaattaccccctgaaatggcaaaaggtggctctctttgaaacggttacgatgttttcaattttggctatttgcgcactactcgccaaatctggtgcattgtcatactaatttcagctgattgttgcttcttccttggcgcttgcttttttttagtaaacctgccaacttcgatccattttatgtacttaacatgtaaatagttcacatagagcactagtatttgtggctcttgttggtgtctccagattcatctgatttttttttcatggagatatttctcatcttgacagatacctcctctaggtgttcatagtgtaactagattttctcttgataagaccagtcaggaaagccaactggtaatggaaaacgtgtcattgtattcttctacggtatatttgtattggtggatggcattttcttcattccacacaacttgaccttgtaatacatataccaatcaacacggcgttgattttgtcaaaaatactttggacctttggttgaaatttaagcatttccttattaatgcttttattaaaatgtaaatttatggaagaaaaggccacttactaatcccagataatttttgtagtaaattagtatcatagttaaaactagaatcagatctaaatgctcaattttgcctgtggcaggttaagtgactgtgttaacctgtgtgatttttttttgggtgggaatatgcaaaaaggtttgtgcatctttgcattaagaaagagagtttgatacaatccgccatgctaggtagcaggccacaacattaaacagattccttgccacatcagctacgacctaggagagacagcagcatgctgctcaaactcagcctcggcatcctgacccctgcagttacccacagctgcacttccttgacgatagcttggatgagctgcgcccaatccctatgtgtatgattgaaaactcggttgttgcactctttccatatcacccaagccaccaggatgacaattgaatcgaagcctcctttttgggttttgttgagtcctcgatacgtgttaaaccaccatgaagcaaagtctgtttgccggactggtaggtgttgcggtatctgcaaagcagtcaggatcacccaccagacctgacaggacttggggcattgcaccagaatgtggtcaatggtctccacttcttgatcgcagaagaggcaattccacctgtgagaaaatcaaacatctttgttaaggagtgtaactggagcaccggctattatgtttcaaactataccaatgataatagaacaggctagttggactgtgtttaaattctagtttcacataataacctttgtagacaatttggtataactaattcactcgttttcttgattgtgcacagccttgggcacaggcagctctaggctgtatgatgtgcagcttgagttgatctactacttctgttgcacacatgatcacaattttataacatttgtgtccttaccaccggcttgcttcttgatgtttgtgggatgtggataaaataatcataatgcatgaatgagcttgcataattaagtgaagataatctgttatatttaaattagagtagcacatgcaatcacctgtctgtacagtagatattgcgatgttcatccatggttggagccttggatgcatgctctgtatagatgcttttatgtttgtctactctacattatctttaggatatgtgattgaaggcgatttgaattttgatattttatggcagatggttcgccctgttgctgtggaggatgtaaagagagaagtgaagattcttaaagaacttaaaggccatgagaatattgttcacttctacaatgcgtttgaagatgactcatatgtatatattgtgatggagtaagtagttatatactagcttctcttacatttcgtgcacaatgttatttgctatatacactccttgcacttacattttatttctacctaaatcctaatacgtctttactgccagttgcattctctatcatttgtttacagtatatgaatatatacacagttcttccaaaatcacatctcgaattcatgtcttcatggcaataaccatttatatggtcagaactcttagtatgctttaccatttccccttgctatgccccaatagtttccaagattatctaaagagagtatgcacgaccacatatgatttccatcagtcatacggtaccaacccttgcttcctttctatttttgcagactatgtgagggtggtgaactattggaccggattttggcaaagtaagattagatatatcctccatttcttcttctgtagttgatacattttcttctatctttttgtgtcatcattctttagtttccattcccgtacagcttctagggccataaggccattacttactggcaccttccattttgtcagaaagaacagccgttatagtgagaaagatgctgcagtggtggtgcggcagatgctcaaagtggcagctgagtgccatctgcatgggctagttcaccgagatatgaagcccgaggtagaaattgaacgctttcaatgtcttggcaattagtgtacattttggtgatatttcattacttctcaggtcatgtaagaatgtacctattttccttcccagaacttccttttcaaatcaaccaaggaggactcacctttaaaggcaacagattttggtctgtcagacttcataaaaccaggtatttatttcaagagcttttgcttatgtgcatctttgctatgtgcttccaattgttgcttctgatttgagtaggacatacaagtctgcagttcattcattgttttctttcattactgtagggaaaaagtttcacgatatagttggcagtgcctattatgtagcaccagaagttttaaaacgacggtctggccctgagtcagatgtttggagcataggagtcataacttatattttgctctgtgggagacgccctttttggaataagacagaggatggcatattcagagaggtaagtgatgaactgttcccaagcttttgcttcaagcaaaatgtgtttggtgagagtgccaaccttttactctgttgtcggtgtgcttatgtgatggaggaccagtgttatctacatttcttcaagttatgcggcattgttaccctgttaacgatgtgtcagtttttataagcatagcttgtattatttttcacacggtagggcacttggctacttggtcaggctgtccttgagtgatgtctgaactagctgtctaaaatacagcctcatcatattttgtgaatgctactccctccgtcccaaaatataagcatttttagctatgaatctggacaactgtgtgtccagattcatagccaaaagttgttatattttaggacggaggtagtaatgttatgactattagagtgagtagcaaaattgaacttcacttctagtttcaattagtatgaatgggcaacctgtggttccaacagccttagcaaccaatgttccagtgcttagttctagacagctggcaccatttgagtatagaatcctcttaggaccattattcccatcagactatgctagatttttttttttgaattacgtgtatttacagaaggagaacattttcagtcttatccgtcatcttgccgtatgtcttctgccagcatatgccacgtcagagaacatttccactttatttgttgaattagaaaataacgatacagagaaaataggcattcaactcaacctgtgaatgcagttacgtacttaggtagtatggtttccctcttcaatgaaccagcattttgttgtaatgctgattatctttgtgcatttaaatcaacatagacatcttgtggtgtacataatcttctgcatccccttgccttctaataatcaggtactaagaaacaagcctgattttcgtaagaagccttggccaggcatcagttcaggtgctaaagatttcgttaaaaagttacttgtaaagaacccaagggcaagattaaccgctgctcaagctctctgtaagttcctacatctaatctaagatagtcttaatacaatagtagtgaatcttcgtcagctgtcaatccttactgtcctgtttatgctttgatatgtttagcgcatccatgggtaagagaaggaggagaagcatctgagatccctgttgatatatctgtattgtccaacatgcgtcagtttgtcaagtacagccgttttaagcaatttgctctgagggtaaattttgtgtgcaactaatcttacatatcttttctcactatatgttcctaatgatgttggtttctttcatgctcaggctttagcaagtacactaaaagaggaagaactagcagatctgaaggaccagttcgatgcaattgatgttgataaaagtggatcaattagtattgaggaaatgcggcatgtaagttcttactggatattcttaatgaaaatgcactttggcacataattgaagtctctgattgtcttttttatgtttcaataggcccttgcaaaggatcttccttggagattgaagggcccccgtgttctcgagattatccaagcagtaagtgtcaggccttctttattattttcccccttattttcggagcaactagcttaccatctatcagagtcgtacttcaactgtgatattattctgtggcagatcgacagcaacactgatggtcttgtggactttgaagagtttgtagcagcaaccctccatatacatcaaatggctgagcttgactctgaaaggtggggcctacgctgccaggctgctttcagcaaatttgatctggatggtgacggatacatcactccagatgaactcagaatggtaagtttcaattcctgttctgtgttcatgttggtttatgtagctacctcatatttagtgaatgaagtgattttgtccacagaagatattatttcttacaccaagaaagaaaatcccagattttcacatatgttagtcgatgctccacatagtaggggcctgtctcatacgtataggaggcctgtttgataaattgaaaagcatttttctttgtgcaacatcgaagaccagtttgttgcagtgtgctatttcagcaattagatgcgagattaattttgactaattaatcctgtataaatgtttggactgtgacagaaacaaaactagtagtatttctcattgaggtttactttcaaggtgcagcacactggcttgaagggttccatcgagccattgctggaggaggccgacatcgacaaagacgggagaataagcttgtcggagttccgcaagctcctgcggacagcgagcatgagcaaccttcccagtccaagaggacctccaaatccacaacccctgtgaacgtcggtaagaaccgagatgagacgtcgtaaattagtcttgtaaaggttgtcttgttcctgtccgcgtgccatgtgatgttgagggtgtcttgagtttttagcatccaggttccgtgtgcagcatgcagataaagtttcggtgtagtacggagtacatacatatttttttcaaaaaaaaatgttacaagcagaaatgctgttctagtctcccattctcctccttgtacataattctatatatgtatgatttgattgcacgtattcatcgcaataaagttgcctgggattgcatgatc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052286.1 RefSeq:Os02g0126400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 05:20, 14 May 2015

The OsCPK4 gene is a member of the complex gene family of calcium-dependent protein kinases in rice (Oryza sativa), and its overexpression confers salt and drought tolerance by preventing membrane lipid peroxidation[1].

Annotated Information

Function

  • The OsCPK4 gene (Os02g0126400) encodes a CDPK containing the four-domain structure typical of CDPKs: an N-terminal variable domain, a Ser/Thr kinase domain, a junction autoinhibitory domain, and a C-terminal calmodulin domain[1] (Fig. 1A).The protective effects of OsCPK4 overexpression in conferring salt and drought tolerance might rely more on the protection against oxidative damage of membranes and the activation of genes involved in lipid metabolismrather than on the activation of the typical salt/drought stressassociated transcriptional networks in root tissues[1].
  • OsCPK4 functions as a positive regulator of the salt and drought stress responses in rice via the protection of cellular membranes from stress-induced oxidative damage. The protective effects of OsCPK4 overexpression in conferring salt and drought tolerance might rely more on the protection against oxidative damage of membranes and the activation of genes involved in lipid metabolismrather than on the activation of the typical salt/drought stressassociated transcriptional networks in root tissues[1]

GO assignment(s): GO:0004672, GO:0004674, GO:0005509, GO:0005524, GO:0006468

Mutation

  • loss-of-function mutants: two transfer DNA (T-DNA) insertion mutants of OsCPK4[1]:

To further investigate the function of OsCPK4, Campo et al. searched for loss-of-function mutants. Two transfer DNA (T-DNA) insertion mutants of OsCPK4 were identified in the POSTECH collection: 2D-00040 (cv Dongjin background) and 1D-03351 (cv Hwayoung background). Both of them contained the T-DNA insertion in the kinase domain of the OsCPK4 gene.

  • In each experiment[1]:
    • wild-type (WT)
    • vector control(pC; three independent lines)
    • OsCPK4 overexpressor (OsCPK4-OX; five independent lines)

Expression

Figure 1. Expression of OsCPK4 in response to salt and drought stress.(from reference [1]).
  • OsCPK4 gene expression is induced by salt and drought stress. OsCPK4 and OsLEA23/OsDip1 share similar expression patterns in response to salt stress, these two genes representing early salt stressresponsive genes[1]:

OsCPK4 was rapidly and transiently activated upon exposure to salt stress in rice roots (Fig. 1C, left). Under drought stress imposed by either air-drying treatment or polyethylene glycol (PEG) treatment, induction of OsCPK4 expression was also observed, its activation being maintained during the entire period of stress treatment (Fig. 1C, middle and right). To assess the effectiveness of treatment, Campo et al. analyzed the expression of the marker gene OsLEA23[2], a dehydrin gene also known as OsDip1 (Fig. 1D). The expression of OsLEA23/OsDip1 is known to be up-regulated by salt and drought stress[2] (earlyresponsive gene). OsLEA23/OsDip1 transcripts increased in response to high-salt conditions, with the highest levels recorded at 1 h of salt treatment and then decreasing at subsequent times of salt treatment (Fig. 1D, left). Air-drying and PEG treatment also induced OsLEA23/OsDip1 expression (Fig. 1D, middle and right).

  • OsCPK4 expression is induced in response to treatment with ABA, the transcriptional activation of OsCPK4 expression in response to salt and drought stress or ABA treatment is accompanied by the accumulation of the OsCPK4 protein in rice roots.

OsCPK4 overexpression confers tolerance to salt and drought stress in rice plants. OsCPK4 knockout results in severe growth inhibition, which suggesting OsCPK4 disruption has a strong impact on plant growth, OsCPK4being required for the normal growth and development of rice plants[1].

  • Overexpression of OsCPK4 results in few transcriptional changes in either root or leaf tissues. In root tissues, OsCPK4 positively regulates the expression of genes involved in metabolic processes, mainly lipid metabolism, as well as genes involved in

protection against oxidative stress. No significant alterations in the expression of salt-associated genes appear to occur in roots of OsCPK4 rice plants, whereas a reduction in the expression of certain salt-associated genes occurs in leaves of OsCPK4 plants[1].

  • OsCPK4 overexpression prevents salt stress-induced lipid peroxidation and electrolyte leakage in cellular membranes under salt stress conditions. Under salt stress conditions, the OsCPK4 transgenic plants accumulate less Na+ in their roots than control plants[1].

Subcellular localization

To localize OsCPK4 in the plant cell, Campo et al. transiently expressed an OsCPK4-GFP fusion gene in onion epidermal cells: A plasma membrane localization of OsCPK4 was observed by transient expression assays of green fluorescent protein-tagged OsCPK4 in onion (Allium cepa) epidermal cells[1].

Evolution

Figure 2.Phylogenetic relationships between CDPKs from rice and Arabidopsis.(from reference [3]).
'Figure 3.Phylogenetic relatedness among the rice, Arabidopsis and functionally characterized CDPKs from other plant species.(from reference [4]).
Figure 4.Phylogenetic relationships among CDPKs from rice (OsCPK1-OsCPK29) and Arabidopsis (AtCPK1-AtCPK34).(from reference [5]).
'Figure 5.Phylogenetic relationships among rice CCaMK, and rice and Arabidopsis CDPKs, CRKs and PEPRKs.(from reference [6]).
  • The phylogenetic tree was created using the ClustalW program based on the alignment of the kinase catalytic domains of 29 rice (OsCPK1-OsCPK29) and 34 Arabidopsis (AtCPK1-AtCPK34) CDPKs. OsCPK21[3] is indicated by an arrow. Phylogenetic analysis showed that rice CDPKs are divided into four distinct classes, OsCPK4 belongs to the Group IV [1][3](Fig. 2).
  • To study the evolutionary relatedness of rice and Arabidopsis CDPKs with all the CDPK genes characterized so far from alfalfa, cucumber, ice plant, mung bean, potato, strawberry, tomato, Petunia, maize, tobacco and Medicago, an unrooted tree was constructed by using ClustalX 1.83. This exercise resulted in four distinct groups similar to that reported by Asano et al.[4][6](Fig. 3).
  • The amplitude of difierential expression for these genes was not as significant as reported earlier, possibly due to use of difierent rice variety and/or experimental conditions. Most of the previously identiWed stress responsive CDPK genes cluster together in

subclades Ia and Ib[4](Fig. 3).

  • Each calcium-dependent protein kinase (CDPK) consists of a variable N-terminal domain, a protein kinase domain, an autoinhibitory region and a calmodulin-like domain with EFhand Ca2+-binding sites. CDPKs are directly activated by the binding of Ca2+ to the calmodulin-like domain, and the activated CDPKs regulate downstream targets. CDPKs have been identified throughout the plant kingdom, and in some protozoans, but not in animals. CDPKs constitute a large multigene family in various plant species; CDPK genes have been identified in Arabidopsis thaliana, and CDPK genes have been found in Oryza sativa (rice)(Fig. 4). The expression and activities of CDPKs are upregulated by a variety of stimuli, such as hormones, abiotic stresses and biotic stresses. Red letters indicate CDPKs involved in abiotic stress signaling[5].
  • Phylogenetic relationships among rice CCaMK, and rice and Arabidopsis CDPKs, CRKs and PEPRKs. A phylogenetic tree was created using the ClustalW program, based on the predicted amino acid sequences of the rice and Arabidopsis kinases, which are indicated by red and blue type, respectively.As shown in Fig. 5, the phylogenetic tree of these kinase sequences forms seven subgroups: CDPKs I–IV, CRKs, CCaMK and PEPRKs. Furthermore, the 29 rice CDPKs were divided into four distinct classes[6].

Knowledge Extension

'Figure 6.Summary of the function of CDPKs in ABA and abiotic stress responses, as reported by several authors(from reference [5]).

In rice, the CDPKs constitute a large family of 29 genes[6]. CDPK genes (OsCPK1-29) contain multiple stress-responsive cis-elements in the promoter region (1 kb) upstream of genes. Analysis of the information extracted from the Rice Expression Database indicates that 11 of the CDPK genes are regulated by chilling temperature, dehydration, salt, rice blast infection and chitin treatment. RT-PCR and RNA gel blot hybridization were performed in this study to detect the expression 19 of the CDPK genes. Twelve CDPK genes exhibited cultivar- and tissue-specific expression; four CDPK genes (OsCPK6, OsCPK13, OsCPK17 and OsCPK25) were induced by chilling temperature, dehydration and salt stresses in the rice seedlings. While OsCPK13 (OsCDPK7) was already known to be inducible by chilling temperature and high salt, this is the first report that the other three genes are stress-regulated. OsCPK6 and OsCPK25 are up-regulated by dehydration and heat shock, respectively, while OsCPK17 is down-regulated by chilling temperature, dehydration and high salt stresses. Based on this evidence, rice CDPK genes may be important components in the signal transduction pathways for stress responses[3][7].

Three major classes of Ca2+-binding proteins have been characterized in higher plants: calciumdependent protein kinases (CDPKs), calmodulins (CaMs) and CaM-like proteins, and calcineurin B-like proteins[5]. The subcellular localization of each CDPK and the phenotypes of overexpression (OX) or knockout or knockdown (KO) lines are described. Red letters, Arabidopsis CDPKs; green letters, rice CDPKs; P, phosphorylation; ABF, ABA-responsive element binding factor; HSP1, a heat shock protein; OST1, open stomata 1 protein kinase[5](Fig. 6).

Labs working on this gene

  • Centre for Research in Agricultural Genomics, Consejo Superior de Investigaciones Científicas-Institut de Recerca i Tecnologia Agroalimentàries-Universitat Autònoma de Barcelona-Universitat de Barcelona, Campus UAB, Bellaterra, Cerdanyola del Valles, 08193 Barcelona, Spain (S.C., P.B., J.M., M.C., B.S.S.)
  • Oryzon Genomics, Cornella de Llobregat, 08940 Barcelona, Spain (E.L.)

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 Campo S, Baldrich P, Messeguer J, et al. Overexpression of a Calcium-dependent protein kinase confers salt and drought tolerance in rice by preventing membrane lipid peroxidation[J]. Plant physiology, 2014, 165(2): 688-704.
  2. 2.0 2.1 Rabbani M A, Maruyama K, Abe H, et al. Monitoring expression profiles of rice genes under cold, drought, and high-salinity stresses and abscisic acid application using cDNA microarray and RNA gel-blot analyses[J]. Plant physiology, 2003, 133(4): 1755-1767.
  3. 3.0 3.1 3.2 3.3 Asano T, Hakata M, Nakamura H, et al. Functional characterisation of OsCPK21, a calcium-dependent protein kinase that confers salt tolerance in rice[J]. Plant molecular biology, 2011, 75(1-2): 179-191.
  4. 4.0 4.1 4.2 Ray S, Agarwal P, Arora R, et al. Expression analysis of calcium-dependent protein kinase gene family during reproductive development and abiotic stress conditions in rice (Oryza sativa L. ssp. indica)[J]. Molecular Genetics and Genomics, 2007, 278(5): 493-505.
  5. 5.0 5.1 5.2 5.3 5.4 Asano T, Hayashi N, Kikuchi S, et al. CDPK-mediated abiotic stress signaling[J]. Plant Signal Behav, 2012, 7(7): 817-821.
  6. 6.0 6.1 6.2 6.3 Asano T, Tanaka N, Yang G, et al. Genome-wide identification of the rice calcium-dependent protein kinase and its closely related kinase gene families: comprehensive analysis of the CDPKs gene family in rice[J]. Plant and cell physiology, 2005, 46(2): 356-366.
  7. Wan B, Lin Y, Mou T. Expression of rice Ca< sup> 2+</sup>-dependent protein kinases (CDPKs) genes under different environmental stresses[J]. FEBS letters, 2007, 581(6): 1179-1189.

Structured Information