|
|
| (108 intermediate revisions by 4 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The gene CAP1 is a highly conserved plant-specific gene that encode an arabinokinase-like protein which is critical for pollen development in both monocotyledonous and dicotyledonous plants. |
| | | | |
| − | ==Annotated Information== | + | =='''Annotated Information'''== |
| − | The gene CAP1 is a highly conserved plant-specific gene that encode a protein of 996 amino acids which appears to act as an arabinokinase.
| |
| | | | |
| − | ===Function=== | + | === '''Function''' === |
| − | Please input function information here.
| |
| | | | |
| − | ===Expression=== | + | '''T'''he gene is composed of 28 exons and encodes a protein of 996 amino acids. It's a member of the galactokinase, homo-Ser kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) superfamily. The N-terminal half of CAP1 contains a glycosyltransferase family 1 domain (30–338 amino acids), while the C-terminal half contains both a Gal-binding (GB) signature (496–540 amino acids) and a GHMP N-terminal (GHMP-N) domain (638–704 amino acids)<ref name="pmid:23629836" />. The GHMP-N domain is involved in ATP binding<ref name="pmid:1846667" /><ref name="pmid:10562426 " />.The protein CAP1 shows high indentity to l-arabinokinase from Arabidopsis, a kinase which catalyzes the conversion of l-arabinose to l-arabinose 1-phosphate. This indicates that CAP1 is a arabinokinase-like protein and might have the same function with l-arabinokinase. |
| − | Please input expression information here.
| |
| | | | |
| − | ===Evolution=== | + | '''G'''enetic analysis indicates that the cap1 mutation has no effect on female reproduction or vegetative growth. But The cap1 heterozygous plant produces equal numbers of normal and collapsed pollen grains, and the collapsed pollen grains lack almost all cytoplasmic materials, nuclei, and intine cell walls and are unable to germinate. Based on the alignment information that CAP1 is a arabinokinase-like protein, cap1 mutant's pollen grain phenotype might be caused by the toxic accumulation of l-arabinose or by the inhibition of cell wall metabolism due to the lack of UDP-l-arabinose derived from l-arabinose 1-phosphate<ref name="pmid:23629836" />. |
| | | | |
| − | A closely related protein, Os06g0702500, was also found in the rice genome. This polypeptide comprised 994 amino acids with 79% amino acid sequence identity to CAP1 (Fig. 3B). Similar proteins were found in many higher plants, including Gramineae and Arabidopsis (between 90% and 71% amino acid identity), the fern Selaginella moellendorffii (67%), and the moss Physcomitrella patens (63%; Figs. 3 and and4).4). In Gramineae, there were at least two similar proteins in a genome that were divided into two phylogenetically distinct clades, the CAP1 clade (with about 90% identity to CAP1) and the Os06g0702500 protein clade (about 80% identity; Fig. 4). The Arabidopsis genome also contained two genes similar to CAP1; AtARA1 (At4g16130) had 75% amino acid identity to CAP1 and encoded arabinokinase (Dolezal and Cobbett, 1991; Gy et al., 1998; Sherson et al., 1999), and At3g42850, tentatively referred to as AtARA2, had 71% identity. Similarly, Os06g0702500 was tentatively termed OsARA1. CAP1 and the other proteins exhibited similar domain structures to AtARA1 (Fig. 3A).
| + | [[File:Genomic structure of the CAP1 locus and pollen phenotypes of allelic mutant lines.jpg]] |
| − | You can also add sub-section(s) at will.
| + | [[File:Genomic structure of the CAP1 locus and pollen phenotypes of allelic mutant lines (2).jpg]] |
| − | [[File:Example.jpg]]
| |
| | | | |
| − | ==Labs working on this gene==
| + | Fig1. Genomic structure of the CAP1 locus and pollen phenotypes of allelic mutant lines[1]. |
| − | Please input related labs here.
| |
| | | | |
| − | ==References== | + | === '''Wild type vs. Mutant''' === |
| − | Please input cited references here.
| + | '''I'''n wild-type plants, almost all pollen grains are uniformly round in shape and contains normal levels of starch. However, in the mutant, 50% pollen grains are abnormal and are smaller in size (approximately 30 µm in diameter) than wild-type pollen grains (40 µm), and many of them are collapsed. The majority of the collapsed grains contain no starch, only in a few cases that a limited number of starch granules are observed. |
| | + | '''I'''n the individual wild-type pollen grains, two identical sperm cell nuclei and one vegetative nucleus are clearly visible. In the mutant, however, none of the collapsed pollen grains contain nuclei, while the pollen grains with normal levels of starch contain normal nuclei. |
| | | | |
| − | ==Structured Information== | + | '''T'''he viable pollen grains from wild-type plants are stained purple by Alexander’s stain, while the aborted pollen grains from mutant plants are blue. |
| − | {{JaponicaGene|
| + | |
| − | GeneName = Os02g0141300|
| + | '''N'''o cell wall fluorescence is detectable from collapsed pollen grains stained with calcofluor white solution, whereas all normal pollen grains emit blue-white fluorescence. |
| − | Description = Galactokinase family protein|
| + | |
| − | Version = NM_001052393.1 GI:115444156 GeneID:4328266|
| + | '''T'''o summarize, mutant pollen grains lost almost all cytoplasm and comprised only exine, so they are empty pollen grains<ref name="pmid:23629836" />. |
| − | Length = 8534 bp|
| + | |
| − | Definition = Oryza sativa Japonica Group Os02g0141300, complete gene.|
| + | [[File:Phenotype and germinability of pollen grains affected by a cap1 mutation.jpg]] |
| − | Source = Oryza sativa Japonica Group
| + | [[File:Phenotype and germinability of pollen grains affected by a cap1 mutation 2.jpg]] |
| | + | |
| | + | Fig2. Phenotype and germinability of pollen grains affected by a cap1 mutation<ref name="pmid:23629836" />. |
| | + | |
| | + | === '''Expression'''=== |
| | + | |
| | + | '''A'''nalyzing by RT-PCR, a very weak signal is detectable in meiotic-stage spikelets (stages 7 and 8) and in microspore stage anthers (stages 9 and 10), and no signal is detected in leaf blades, roots, lemmas/paleas, or flowering-stage pistils, nor in tricellular pollen stage anthers (stages 12 and 13), while a prominent signal is detected in anthers at the bicellular pollen stage (stage 11). |
| | + | |
| | + | '''B'''y in situ hybridization, no signal is detected in the anther of microspore (stage 10), bicellular pollen (stage 11), and tricellular pollen (stage 13) stages using a digoxigenin (DIG)-labeled CAP1 sense probe as a control. By contrast, the hybridization signals by a DIG-labeled CAP1 antisense probe are present not only in developing pollen, but also in tapetum and endothecium (anther wall). |
| | + | |
| | + | '''I'''n summary, CAP1 is preferentially expressed in anthers during pollen development. The developmental stage, when increased CAP1 expression is observed, coincided with the timing of morphological and biochemical alterations in cap1 mutants, suggesting that CAP1 is closely associated with bicellular-stage pollen at stage 11<ref name="pmid:23629836" />. |
| | + | |
| | + | [[File:Gene expression pattern of CAP1..jpg]] |
| | + | [[File:Gene expression pattern of CAP1. (2).jpg]] |
| | + | |
| | + | Fig3. Gene expression pattern of CAP1<ref name="pmid:23629836" />. |
| | + | |
| | + | === '''Evolution''' === |
| | + | |
| | + | '''A''' closely related protein Os06g0702500 is found in the rice genome which encodes a protein with 79% identity to CAP1 and is termed OsARA1. |
| | + | |
| | + | '''S'''imilar proteins could be found in many higher plants, including Gramineae and Arabidopsis (between 90% and 71% identity), the fern Selaginella moellendorffii (67%), and the moss Physcomitrella patens (63%). |
| | + | |
| | + | '''I'''n Gramineae, there are at least two similar proteins in a genome that are divided into two phylogenetically distinct clades, the CAP1 clade (with about 90% identity to CAP1) and the OsARA1 clade (about 80% identity). |
| | + | |
| | + | '''S'''imilaraly, the Arabidopsis genome also contains two genes similar to CAP1; AtARA1 (At4g16130) has 75% identity to CAP1 and encods an arabinokinase<ref name="pmid:16668327 " /><ref name="pmid:9524266 " /><ref name="pmid:10344205 " />, and AtARA2, has 71% identity. |
| | + | |
| | + | '''I'''n bacteria or animal genomes, no highly homologous proteins could be found, which indicates that CAP1 is a highly conserved plant-specific gene<ref name="pmid:23629836" />. |
| | + | |
| | + | [[File:Phylogenetic tree of CAP1 and related proteins in plants.jpg]] |
| | + | |
| | + | Fig4. Phylogenetic tree of CAP1 and related proteins in plants<ref name="pmid:23629836" />. |
| | + | |
| | + | =='''Labs working on this gene'''== |
| | + | |
| | + | 1. Department of Biological Production, Faculty of Bioresource Sciences, Akita Prefectural University, Akita 010–0195, Japan (K.U., F.Y., H.W.) |
| | + | |
| | + | 2. Department of Genetics, The University of Melbourne, Parkville, Australia, 3052. |
| | + | |
| | + | 3. Institut de Biotechnologie des Plantes, Laboratoire de Biologie du Développement des Plantes, Bâtiment 630, Université de Paris-Sud, CNRS-ERS 569, F-91405, Orsay, Cedex, France. |
| | + | |
| | + | =='''References'''== |
| | + | |
| | + | <references> |
| | + | <ref name="pmid:23629836"> Ueda K, Yoshimura F, Miyao A, Hirochika H, Nonomura K, Wabiko H. Collapsed abnormal pollen1 gene encoding the Arabinokinase-like protein is involved in pollen development in rice. Plant Physiol. 2013 Jun;162(2):858-71.</ref> |
| | + | <ref name="pmid:1846667"> Tsay YH, Robinson GW. (1991) Cloning and characterization of ERG8, an essential gene of Saccharomyces cerevisiae that encodes phosphomevalonate kinase. Mol Cell Biol 11: 620–631. </ref> |
| | + | <ref name="pmid:10562426 "> Lee M, Leustek T. (1999) Identification of the gene encoding homoserine kinase from Arabidopsis thaliana and characterization of the recombinant enzyme derived from the gene. Arch Biochem Biophys 372: 135–142. </ref> |
| | + | <ref name="pmid:16668327 "> Dolezal O, Cobbett CS. (1991) Arabinose kinase-deficient mutant of Arabidopsis thaliana. Plant Physiol 96: 1255–1260.</ref> |
| | + | <ref name="pmid:9524266 "> Gy I, Aubourg S, Sherson S, Cobbett CS, Cheron A, Kreis M, Lecharny A. (1998) Analysis of a 14-kb fragment containing a putative cell wall gene and a candidate for the ARA1, arabinose kinase, gene from chromosome IV of Arabidopsis thaliana. Gene 209: 201–210. </ref> |
| | + | <ref name="pmid:10344205 "> Sherson S, Gy I, Medd J, Schmidt R, Dean C, Kreis M, Lecharny A, Cobbett C. (1999) The arabinose kinase, ARA1, gene of Arabidopsis is a novel member of the galactose kinase gene family. Plant Mol Biol 39: 1003–1012.</ref> |
| | + | </references> |
| | + | |
| | + | =='''Structured Information'''== |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:2230686..2239219|
| |
| − | CDS = 2231383..2231493,2231646..2231849,2231945..2232016,2232293..2232458,2232543..2232758<br>,2232873..2232949,2233056..2233151,2233237..2233280,2233435..2233522<br>,2233805..2233886,2233961..2234091,2234264..2234386,2234804..2234887<br>,2234985..2235144,2235251..2235414,2235823..2235879,2236159..2236278<br>,2236387..2236496,2236587..2236689,2236789..2236842,2237106..2237168<br>,2237258..2237325,2237412..2237469,2237684..2237750,2238233..2238309<br>,2238433..2238516,2238652..2238828,2239010..2239144|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:2230686..2239219
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:2230686..2239219
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgaggattcggggagacggcggaggtgatgaggaggaggcggcgatggcggtggtgtcggcgccgccgcagcatctggtcttcgcgtactacatcaccggccatggcttcggccacgccacccgcgcgctcgaggtggtgaggcacctgatcgcggcggggcacgacgtgcacgtggtcaccggcgcgccggagttcgtcttcaccaccgagatcagctcgcccaacctccacatccgcaaggtgctcctcgactgcggcgccgtccaggccgacgccctcaccgtcgatcgcctcgcctccctcgagaagtatcatcagacggccgtgatgccacgcgaatcgattctgaggactgaggtggaatggctcaacacgatcaaggccgacctagtggtttcagatgtcgtccccgtcgcgtgcagggcggctgcggatgctggcattcgatcggtgtgcgtcaccaatttcagctgggacttcatttatgcagagtatgtcgtagtagctggacatcatcatcgctcaattgtgtggcagatagcagaagattattcacattgtgaattcttactacgactccctggatactgccctatgcctgctttccgtgatgtcattgatgttcctcttgtggtgagaagattgcataaatctagatctgaggtgaggaaggaattaggaattaaagatgatgttaaggtggtcattttcaactttggaggacagcctgcaggatggaaactgaagaaagaatggctgcctgatggttggctctgtttggtatgtggtgcatctgaaactcaagagcttccaccaaatttcattaaacttgcaaaggacgcctatacacctgatttgatggcagcatctgactgcatgcttgggaaaattggatatggcactgtgagtgaggctttggcttacaagctgccatttgtatttgttcgtagagattatttcaatgaagagccgtttttgaggaatatgcttgagcattatcaatgtggcgttgagatggtacggagggatttacttactggacactggaaaccttatctgcaacgtgctatgacacttcatccatgctatgatggtccaataaatggtggtgaggtggctgcacatatcctccaggacactgctgttggcaagaagtatatttctggcaagttgagcggagcaagacgtttgcgtgatgccatagtgctaggatatcaactacaaagggctccagggagagatgtcggaattcctgactggtattctgtgtctgagaaagaaatcggtgttcgtccagcaccaacatatcatgaggttaatggaagtgcagagtcatcttttgaggacttcgagatactccatggggacatacaaggattaactgatacaatggcatttttaactagtttatcaggacttgttggaaatgatccaaggagccctgagaagcaatctcgagagagggttgctgcttctgttttctttgattgggaggaggaaatatatgttgcaagagcacctggacgtttagatgtcatgggtggcatcgcagattattcaggaagtcttgtattacagatgcccattcgagaggcttgtcatgttgctattcagagaagtaatcctatgaagcagaagctatggaagcatacacaagctaggcaactagcaaatggcagagcagtgccgttgttacaaattgtatcatttggttctgaattgagtaatcgtgcaccaacctttgatatggacctgtctgattttatggatggtgacaaaccaatatcctatgataaggccaaagaatatttctctcaggacccatcccaaaaatgggctgcatatgttgctggaacaatccttgtgttgatgaccgagctaggtgtggtcttcacagacagcatgagcattctggtttcttcatcagttcctgaaggtaaaggtgtctcctcttctgcatcagtggaggttgccagtatgtctgctattgctgctgcctatggtctaaatatccctccacgggatcttgccatactctgccaaaaggttgagaatcgcattgttggagcaccttgtggtgtaatggatcaaatgacatctgcttgtggagaagctaacaaacttcttgcaatgatttgtcagcctgcagaagtgaaagagttggtcagcattccaactcacattcgattttggggtcttgactctgggatacgacatagtgttggtgggactgattatggctctgtaagggtaggcacttacatgggacgcaagatgatcaagtgtgctgcatctgatcttctttcagaatcattaccctcctgtcctcctattcaatcaggcaacacaaattctgatgaatacgaagaacatggtgtagatcttttgaaatctgaagcgtcgctggagtatttatgcaacctaccacctcatagatatgaagctgtttacgcgagagatattccagagatcataaccggggatgcatttttggagaagtatggagatcataatgatgcagtaacaactgttgacccaaaacgatcttactgtgtgaaggctcctactagacatcctatatacgagaacttccgagttgaggccttcaaagcattgctaacagcagccaaaacagttgagcaactttcggcccttggagaattgatgtatcagtgccactacagctacaatgcttgtgggcttggttctgatggaaccgacaggcttgttaatatggtacaagaagtccagcacaggaagacctcacaggatggtggtcctagtttatttggtgcaaagataactggtggaggatctgggggctcggtttgtgtcattgggaaaaattgcttgaaaagcagtgaagagatttttgagattcagaagagatacaaagctgctaccgggtacctaccaattgttttcgagggctcatctccaggtgcaggcaagtttggatacctgaagattcgacggcgatccacatag</cdnaseq>|
| |
| − | AA = <aaseq>MRIRGDGGGDEEEAAMAVVSAPPQHLVFAYYITGHGFGHATRAL EVVRHLIAAGHDVHVVTGAPEFVFTTEISSPNLHIRKVLLDCGAVQADALTVDRLASL EKYHQTAVMPRESILRTEVEWLNTIKADLVVSDVVPVACRAAADAGIRSVCVTNFSWD FIYAEYVVVAGHHHRSIVWQIAEDYSHCEFLLRLPGYCPMPAFRDVIDVPLVVRRLHK SRSEVRKELGIKDDVKVVIFNFGGQPAGWKLKKEWLPDGWLCLVCGASETQELPPNFI KLAKDAYTPDLMAASDCMLGKIGYGTVSEALAYKLPFVFVRRDYFNEEPFLRNMLEHY QCGVEMVRRDLLTGHWKPYLQRAMTLHPCYDGPINGGEVAAHILQDTAVGKKYISGKL SGARRLRDAIVLGYQLQRAPGRDVGIPDWYSVSEKEIGVRPAPTYHEVNGSAESSFED FEILHGDIQGLTDTMAFLTSLSGLVGNDPRSPEKQSRERVAASVFFDWEEEIYVARAP GRLDVMGGIADYSGSLVLQMPIREACHVAIQRSNPMKQKLWKHTQARQLANGRAVPLL QIVSFGSELSNRAPTFDMDLSDFMDGDKPISYDKAKEYFSQDPSQKWAAYVAGTILVL MTELGVVFTDSMSILVSSSVPEGKGVSSSASVEVASMSAIAAAYGLNIPPRDLAILCQ KVENRIVGAPCGVMDQMTSACGEANKLLAMICQPAEVKELVSIPTHIRFWGLDSGIRH SVGGTDYGSVRVGTYMGRKMIKCAASDLLSESLPSCPPIQSGNTNSDEYEEHGVDLLK SEASLEYLCNLPPHRYEAVYARDIPEIITGDAFLEKYGDHNDAVTTVDPKRSYCVKAP TRHPIYENFRVEAFKALLTAAKTVEQLSALGELMYQCHYSYNACGLGSDGTDRLVNMV QEVQHRKTSQDGGPSLFGAKITGGGSGGSVCVIGKNCLKSSEEIFEIQKRYKAATGYL PIVFEGSSPGAGKFGYLKIRRRST</aaseq>|
| |
| − | DNA = <dnaseqindica>7727..7837#7371..7574#7204..7275#6762..6927#6462..6677#6271..6347#6069..6164#5940..5983#5698..5785#5334..5415#5129..5259#4834..4956#4333..4416#4076..4235#3806..3969#3341..3397#2942..3061#2724..2833#2531..2633#2378..2431#2052..2114#1895..1962#1751..1808#1470..1536#911..987#704..787#392..568#76..210#gtggagtctctgataataagtgtcgatttttgttgttccgggagaaattccgggagatttggggcggcggcggcgatgaggattcggggagacggcggaggtgatgaggaggaggcggcgatggcggtggtgtcggcgccgccgcagcatctggtcttcgcgtactacatcaccggccatggcttcggccacgccacccgcgcgctcgaggtctcgtcttctcttttttctcgttttggggaggattgattcgtgtttgtctccgtgcgatgaaattttggtttctgcgcggaattttggtttcgtggctggatggatggattcgctgctgtttgagtttttttttaatttttatttggggtgatggaattttggtttgtggttagtgcaggtggtgaggcacctgatcgcggcggggcacgacgtgcacgtggtcaccggcgcgccggagttcgtcttcaccaccgagatcagctcgcccaacctccacatccgcaaggtgctcctcgactgcggcgccgtccaggccgacgccctcaccgtcgatcgcctcgcctccctcgagaaggttccagaaacatactccaatatctccactctactacctgctactgctacaacatccaccactcttgctcttgctgtgctgtgctttgcctgtggatttgtggctgattgagtgattgtgtggtgcggaatgcagtatcatcagacggccgtgatgccacgcgaatcgattctgaggactgaggtggaatggctcaacacgatcaaggccgacctagtggtaatgctcctgaggatgctaacaccaactacttgctcgatttttttaatctgtttttatccggggtctccatgaatctttacagcatctgaagcaaatgtggtgttgttggtctttggtcaggtttcagatgtcgtccccgtcgcgtgcagggcggctgcggatgctggcattcgatcggtgtgcgtcaccaatttcaggttagtgtttctgtggttgcttcatgctaggggtcaaaaggagcaatgaggatgtagagtgagctttagaattattagttacagcctttgtgggttcccatattattccaagtttatgttaacattttgcttggggttatatgtttcatcagtgcatagttgctacagttacctgacttttatatgttttgcctgctaacattcatttcctgatgtaatcagtactaacgctgaacacaaaagttatctactaacccacaagaaatctgcagctctgagtgatgctaacaataaattttagttatggctttacccgaaattgactagttgtaaacataattttttctctccatttatttttataattcgggctattgaagaaatttacatggatagttttatttgcagtttttcttgcttcttttttgagtagttatttttgaatcaaagcacggtctttaattttcaccttctatttgcagctgggacttcatttatgcagagtatgtcgtagtagctggacatcatcatcgctcaattgtgtggcaggtgcctgtcatttcatttcccaaaaatggtgcaaaattgtctaattggtttgctaatgctaactactaaattcctaaagccacctagacaccggattcaaatttcttgatttttttttgagaaaactgttctctgtaatatcgttctttagttgcaagttgagactaattcagcccgttcaataaccatgcatttatgttggcatcaactgcagatagcagaagattattcacattgtgaattcttactacgactccctggatactgccctagtacgtctatatgtctgaatgaataatatatccaaagatcctgcatgttggtttgaagtactcgtgattaattctatcttctgcagtgcctgctttccgtgatgtcattgatgttcctcttgtggtgagaagattgcataaatctagatctgaggtgcgtacaactctgctggacaatgtttgctctgaacactcaacccatgttctcagttcttgatgacttaaaaaatctccatatatcaggtgaggaaggaattaggaattaaagatgatgttaaggtggtcattttcaactttggaggacaggtaaaccattaaatagcctgaatgttctttctcgtttatagatgctcgattttgttcaattaatggatgttagttgcatatttctgttaaatcatttttttttgaaagggctatatttatgttaaatcaatatgtccttttagaccagctaaggtttctgtctttctgctgttattggtagtcagtacaatccatagttgaatttgctaccatcttatgcaagtattgctgatgcaatgccattgtgatggtttcctcttcagcctgcaggatggaaactgaagaaagaatggctgcctgatggttggctctgtttggtatattttctttgaaactacgtgttttcttctctcttctttctctctctcttaataatgtctggacaacatttgtgaccaaattctattttcataaaggtatgtggtgcatctgaaactcaagagcttccaccaaatttcattaaacttgcaaaggacgcctatacacctgatttgatggcagcatctgactgcatgcttggtaaatacagtgctatattatctgtgttagggctatttaccgccttatttcttttctagaaatgtaacaattctgttggttgttgcatagggaaaattggatatggcactgtgagtgaggctttggcttacaagctgccatttgtatttgttcgtagagattatttcaatgaagagccgtttttgaggaatatgcttgaggttgaaacatctcgaagtatagtttcattttaagaattcgtacttatagagcatcagtcatgaaccttgatgtcctgttctatatcctcttttcttcctaataaacagcattatcaatgtggcgttgagatggtacggagggatttacttactggacactggaaaccttatctgcaacgtgctatgacacttcatccatgctatgatggtccaataaatggtggtgaggtaatgtccttacagttctcagatatgggtctgtgagggttgtttgggaactcaagctagtaaccatcttgtaaattttattttttttttatgatggctgatttttaaaactgaaataccatactagccataggttgaagttcatcctgaatcaattcttccgtaagtcatgaagagtcaactggatacttgcatcatgttttcctcaaaccagatgtgattcacagactttcttgattgcatttataatacaagataagctaataattattcgttcaggtggctgcacatatcctccaggacactgctgttggcaagaagtatatttctggcaaggtgagttactaacataaattgttgatacattattgttcagttgtaccttgaaactttcagataaaagtgagactttgatatcttcagttatctgtatttggtgtcgtatggaacttttgttgctttcatactacacatataaagtgataagttgaacataagtaaacacttctgccttttcttgtcatgttactcattaaaagcatttcacccctggaggtttttattaattcttttgctcaagaatattttttttatggaactgtccacctagttgctaattcccaattcagaacagaggatttatctactgctctggaacttgaaaacctatgaagttttaaagttacaagagttttttttttcacaacttctggacttagtatttgcactactctacaattacagttgagcggagcaagacgtttgcgtgatgccatagtgctaggatatcaactacaaagggctccagggagagatgtcggaattcctgactggtattctgtgtctgagaaagaaatcggtgttcgtccagcaccaacatatcatgaggttaatggaagtgcagagtcgtaagtttccatatcctttcttttcccctcataataacatgtactttatccaataacacactttatcatatccccgtccattcaaataattttgttttggtgtcagatcttttgaggacttcgagatactccatggggacatacaaggattaactgatacaatggcatttttaactagtttatcaggacttgttggaaatgatccaaggagccctgagaagcaatctcgagagagggttgctgcttctgttttctttgattgggaggtactatacaagcataaaaataatacactgatttttttgggaaactattgatatgttataggggaaaatcattttcgaatgatttattctgttgtaggaggaaatatatgttgcaagagcacctggacgtttagatgtcatgggtggcatcgcagattattcaggaagtcttgtattacaggtagtttcaaatgcaagagaaagtggcatttcttatagatgagccttcctgtaattccactatgtgataaaactttcacacaaatgatttcaaattttcaatatttaaagattcttcaattctgcatttgactatcattttagtttgtttctgtaactttccttgcatctcctcttgataccattgaaggtaggggttcctcctgcatgtattgtggaatgatatattgacatatacctggaaaactctgaatacatgcatgttctatagaccttcctacaattatttttagatagatgaataaatattatgtctccttgtaagttactaagttattgattgatttgatatatttaaaacataaagaaagtttcttttggcatatgcgattgacattgagatggtccaaattaccagatgcccattcgagaggcttgtcatgttgctattcagagaagtaatcctatgaagcagaagctatggaagcatacacaagctaggcaactagcaaatggcagagcagtgccgttgttacaaattgtatgttatttatcactaactctctaagcatcttcgcttaccttttcttatccttattatgcgttcttaaaacttaattcatttgacaaccaaagatgtagcatatatttagttggatgcttcacagctcatttggacgactgggatcttcttactaaatatgtctgtacaggtatcatttggttctgaattgagtaatcgtgcaccaacctttgatatggacctgtctgattttatggatggtgacaaaccaatatcctatgataaggccaaagaatatttctctcaggacccatcccaaaagtaagaaagatcgtttgttttactctataaaaatcataacttgtcatgcatattcattcttggttctggttcagatgggctgcatatgttgctggaacaatccttgtgttgatgaccgagctaggtgtggtcttcacagacagcatgagcattctggtaagctttgatcctttctgttttcaatcagaatgcagtaatatatgtaaaattccacctctttgtccagtttgtcacctttctcatattggggagataaagagatattcagaactcaaaaggaatattgtttattagtcacaaaaagaaaacagcatctttcacactttctccttccacattctaatcaatcaagtgtttccttccacattctaatcaatcaagtgttctaactcgaatgtttgtattggtcattcatgataattttatttgaatcctcaggtttcttcatcagttcctgaaggtaaaggtgtctcctcttctgcatcagtggaggttgccagtatgtctgctattgctgctgcctatggtaaacgattgacttgaacatctttgttgtaataatgccactattttctttcttttggttggatatctagttctgcagcagccaccactgttgcacatttaacttaactgggcgtgctagttgacatcaattcatgttcttgtcttggcttcaggtctaaatatccctccacgggatcttgccatactctgccaaaaggtaaagtactaataaatgaagggatatagcttcagaatgtggtaggtcttctattgcagagagtcattctttggtgactatgcaggttgagaatcgcattgttggagcaccttgtggtgtaatggatcaaatgacatctgcttgtggagaagctaacaaacttcttgcaatgatttgtcaggttagtaagggtacccagctcttggaggaagtagctaccagacccagtcattcctcagtccaactttgcatttcctctataattaattgatcaaattttgctgcagcctgcagaagtgaaagagttggtcagcattccaactcacattcgattttggggtcttgactctgggatacgacataggtaaatactttccatattgatatcttttgcaagattggttttattgttgggatgcatggtttggttttattgttgggatgcatagttaaccataatcttctttggttcatgcagtgttggtgggactgattatggctctgtaagggtaggcacttacatgggacgcaagatgatcaagtgtgctgcatctgatcttctttcagaatcattaccctcctgtcctcctattcaatcaggcaacacaaattctgatgaatacgaagaacatggtgtagatcttttgaaatctgaagcgtcgctggagtatttatgcaacctaccacctcataggtctcattaccttgatattgacagcaaattttatatggtccttcatagtgtatgccaggttttatgactttggcaaaatttcagatatgaagctgtttacgcgagagatattccagagatcataaccggggatgcatttttggagaagtatggagatcataatgatgcagtaacaactgttgacccaaaacgatcttactgtgtgaaggctcctactagacatcctatatacgagaacttccgagttgaggtttgatatcataaaaccagaatatctacacctctcgattcataatggctgttgatgagatccctgcatgttgttgtctgatgttctactgcttttgctgctttatcctcgttgtttgtatttttaaactttaaaataattctttgagatgtttgcaaatcagaaaactatcttgagagcgcatggttttcagaaccagctttattttttctccataaagaatagcttattcctttcactgatatttttgacacttgttatgcttctcacgtgtaggccttcaaagcattgctaacagcagccaaaacagttgagcaactttcggcccttggagaattgatgtatcaggtatctgtattacaaatgaaagcccagcactgtacatgttgattcacaaaattagcagtcagtggcactgcattgacccttttgttttctggcagtgccactacagctacaatgcttgtgggcttggttctgatggaaccgacaggcttgttaatatggtacaagaagtccagcacaggaagacctcacaggatggtggtcctagtttatttggtgcaaagataactggtggaggatctgggggctcggtttgtgtcattgggaaaaattgcttgaaaagcagtgaagagatttttgaggtattttcgacatcgttttttattgtcagttgtacacaatggatgaccataactacaaagatccaagataaaccctccaagagagttgtgattcaccataatgtttgcattttcatggtattgcatgctaacaaaatatcatttgttttcagattcagaagagatacaaagctgctaccgggtacctaccaattgttttcgagggctcatctccaggtgcaggcaagtttggatacctgaagattcgacggcgatccacatagccatcaatcagcctaactgaagatttggctgtattttaggtccacacaaacatttgtcaggaacctgaatattacctgttcatatggaacacatatcacatcatcccattatgtagtagtaataagctctctagttcatgcaataattctagtgattagtgcacctctggtgcagacttccattgtgtaagtgcagtatccagataataaaatggaagtctttagattgatgttctgcaatagctgatagcctcaacaccatccatttgcatgggtacacagtggctaccgacttcaactattggatcggaggctatgcatgcatcaaggagcagttgcatttgcaagggacaagacatggcttctgatcaagcagacagcagatgcaaactgggcattgtagagtagcagcatggccttctgttttcagatggcaagttgtgctaacctggagagatctgaatgttcagagagtaacacatccttttctccttttttggtagtatcaagcagctggatgatgatttcattcagccttatcatgaatagggcttagttagtgtattatctggaacaatcatttagcagaataattgatcagttagcttagctctagcttcttgttagagttttgttactgtttgcagaagttgatgccagaaagttgtctagaatcagagttatactgttgcctgac</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052393.1 RefSeq:Os02g0141300]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
The gene CAP1 is a highly conserved plant-specific gene that encode an arabinokinase-like protein which is critical for pollen development in both monocotyledonous and dicotyledonous plants.
Annotated Information
Function
The gene is composed of 28 exons and encodes a protein of 996 amino acids. It's a member of the galactokinase, homo-Ser kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) superfamily. The N-terminal half of CAP1 contains a glycosyltransferase family 1 domain (30–338 amino acids), while the C-terminal half contains both a Gal-binding (GB) signature (496–540 amino acids) and a GHMP N-terminal (GHMP-N) domain (638–704 amino acids)[1]. The GHMP-N domain is involved in ATP binding[2][3].The protein CAP1 shows high indentity to l-arabinokinase from Arabidopsis, a kinase which catalyzes the conversion of l-arabinose to l-arabinose 1-phosphate. This indicates that CAP1 is a arabinokinase-like protein and might have the same function with l-arabinokinase.
Genetic analysis indicates that the cap1 mutation has no effect on female reproduction or vegetative growth. But The cap1 heterozygous plant produces equal numbers of normal and collapsed pollen grains, and the collapsed pollen grains lack almost all cytoplasmic materials, nuclei, and intine cell walls and are unable to germinate. Based on the alignment information that CAP1 is a arabinokinase-like protein, cap1 mutant's pollen grain phenotype might be caused by the toxic accumulation of l-arabinose or by the inhibition of cell wall metabolism due to the lack of UDP-l-arabinose derived from l-arabinose 1-phosphate[1].
Fig1. Genomic structure of the CAP1 locus and pollen phenotypes of allelic mutant lines[1].
Wild type vs. Mutant
In wild-type plants, almost all pollen grains are uniformly round in shape and contains normal levels of starch. However, in the mutant, 50% pollen grains are abnormal and are smaller in size (approximately 30 µm in diameter) than wild-type pollen grains (40 µm), and many of them are collapsed. The majority of the collapsed grains contain no starch, only in a few cases that a limited number of starch granules are observed.
In the individual wild-type pollen grains, two identical sperm cell nuclei and one vegetative nucleus are clearly visible. In the mutant, however, none of the collapsed pollen grains contain nuclei, while the pollen grains with normal levels of starch contain normal nuclei.
The viable pollen grains from wild-type plants are stained purple by Alexander’s stain, while the aborted pollen grains from mutant plants are blue.
No cell wall fluorescence is detectable from collapsed pollen grains stained with calcofluor white solution, whereas all normal pollen grains emit blue-white fluorescence.
To summarize, mutant pollen grains lost almost all cytoplasm and comprised only exine, so they are empty pollen grains[1].
Fig2. Phenotype and germinability of pollen grains affected by a cap1 mutation[1].
Expression
Analyzing by RT-PCR, a very weak signal is detectable in meiotic-stage spikelets (stages 7 and 8) and in microspore stage anthers (stages 9 and 10), and no signal is detected in leaf blades, roots, lemmas/paleas, or flowering-stage pistils, nor in tricellular pollen stage anthers (stages 12 and 13), while a prominent signal is detected in anthers at the bicellular pollen stage (stage 11).
By in situ hybridization, no signal is detected in the anther of microspore (stage 10), bicellular pollen (stage 11), and tricellular pollen (stage 13) stages using a digoxigenin (DIG)-labeled CAP1 sense probe as a control. By contrast, the hybridization signals by a DIG-labeled CAP1 antisense probe are present not only in developing pollen, but also in tapetum and endothecium (anther wall).
In summary, CAP1 is preferentially expressed in anthers during pollen development. The developmental stage, when increased CAP1 expression is observed, coincided with the timing of morphological and biochemical alterations in cap1 mutants, suggesting that CAP1 is closely associated with bicellular-stage pollen at stage 11[1].
Fig3. Gene expression pattern of CAP1[1].
Evolution
A closely related protein Os06g0702500 is found in the rice genome which encodes a protein with 79% identity to CAP1 and is termed OsARA1.
Similar proteins could be found in many higher plants, including Gramineae and Arabidopsis (between 90% and 71% identity), the fern Selaginella moellendorffii (67%), and the moss Physcomitrella patens (63%).
In Gramineae, there are at least two similar proteins in a genome that are divided into two phylogenetically distinct clades, the CAP1 clade (with about 90% identity to CAP1) and the OsARA1 clade (about 80% identity).
Similaraly, the Arabidopsis genome also contains two genes similar to CAP1; AtARA1 (At4g16130) has 75% identity to CAP1 and encods an arabinokinase[4][5][6], and AtARA2, has 71% identity.
In bacteria or animal genomes, no highly homologous proteins could be found, which indicates that CAP1 is a highly conserved plant-specific gene[1].
Fig4. Phylogenetic tree of CAP1 and related proteins in plants[1].
Labs working on this gene
1. Department of Biological Production, Faculty of Bioresource Sciences, Akita Prefectural University, Akita 010–0195, Japan (K.U., F.Y., H.W.)
2. Department of Genetics, The University of Melbourne, Parkville, Australia, 3052.
3. Institut de Biotechnologie des Plantes, Laboratoire de Biologie du Développement des Plantes, Bâtiment 630, Université de Paris-Sud, CNRS-ERS 569, F-91405, Orsay, Cedex, France.
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Ueda K, Yoshimura F, Miyao A, Hirochika H, Nonomura K, Wabiko H. Collapsed abnormal pollen1 gene encoding the Arabinokinase-like protein is involved in pollen development in rice. Plant Physiol. 2013 Jun;162(2):858-71.
- ↑ Tsay YH, Robinson GW. (1991) Cloning and characterization of ERG8, an essential gene of Saccharomyces cerevisiae that encodes phosphomevalonate kinase. Mol Cell Biol 11: 620–631.
- ↑ Lee M, Leustek T. (1999) Identification of the gene encoding homoserine kinase from Arabidopsis thaliana and characterization of the recombinant enzyme derived from the gene. Arch Biochem Biophys 372: 135–142.
- ↑ Dolezal O, Cobbett CS. (1991) Arabinose kinase-deficient mutant of Arabidopsis thaliana. Plant Physiol 96: 1255–1260.
- ↑ Gy I, Aubourg S, Sherson S, Cobbett CS, Cheron A, Kreis M, Lecharny A. (1998) Analysis of a 14-kb fragment containing a putative cell wall gene and a candidate for the ARA1, arabinose kinase, gene from chromosome IV of Arabidopsis thaliana. Gene 209: 201–210.
- ↑ Sherson S, Gy I, Medd J, Schmidt R, Dean C, Kreis M, Lecharny A, Cobbett C. (1999) The arabinose kinase, ARA1, gene of Arabidopsis is a novel member of the galactose kinase gene family. Plant Mol Biol 39: 1003–1012.
Structured Information