|
|
| Line 38: |
Line 38: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os02g0552700|
| |
| − | Description = Zinc finger, CCHC-type domain containing protein|
| |
| − | Version = NM_001053643.1 GI:115446656 GeneID:4329640|
| |
| − | Length = 1559 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0552700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:21704297..21705855|
| |
| − | CDS = 21704755..21705669|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:21704297..21705855
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:21704297..21705855
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgcttttgaggtcgattggtcaagcatctcacctcacagatgatcctcctgatgagaaaacggatgcaactaaaattaaggcgtggaaaacagcagatgatcgtgttatgggattcatattcatgagtgtagaggtgcctattcggatgagtttcagggatcacactaccgctaaagagatgtgggactacctcaaacagaggtacactcaagaaagcggagctttgcgtttttccttgctgcagaatttgcacaacttacaacaacaagatcagtccattgaagaattttataatgcctttactcggttgtctggacagcttgaggcacagactccaaaaggtgcttcaggttgtgcacaatgcaaggcgagagagaagcatgatcaagaaaatctagtgtatcaatttgtcatgagactttcctctcaatttgagtccattcgagttcagttgcttggacgtcctacacgtcctactatggcggaggctcttgcagatctaatcgctgaggagacacgtctttgttccttggacactactcctactcctgtggttactcacaatgtcatggcagcacctcagcgtgttggagctcctatgggcgggatccctgaattcagttccatcgccaaaagtgatcgtatttgctctcattgcaagaaggttggacatatttccgatgattgcttctatcttcatccagagaagttggctgattatcaagctaggcgtgcagcggtcccccgtcctcgtgcgacggctagtgctcctgttttcttggatatcactgctgctggtccttctagtactagtgctggtggcagtgcctctagcgccgtctcatgtgctcctcagtcattggttgcaagaccgtcttatcaagccagtgattggtcatggccatcaccatag</cdnaseq>|
| |
| − | AA = <aaseq>MLLRSIGQASHLTDDPPDEKTDATKIKAWKTADDRVMGFIFMSV EVPIRMSFRDHTTAKEMWDYLKQRYTQESGALRFSLLQNLHNLQQQDQSIEEFYNAFT RLSGQLEAQTPKGASGCAQCKAREKHDQENLVYQFVMRLSSQFESIRVQLLGRPTRPT MAEALADLIAEETRLCSLDTTPTPVVTHNVMAAPQRVGAPMGGIPEFSSIAKSDRICS HCKKVGHISDDCFYLHPEKLADYQARRAAVPRPRATASAPVFLDITAAGPSSTSAGGS ASSAVSCAPQSLVARPSYQASDWSWPSP</aaseq>|
| |
| − | DNA = <dnaseqindica>459..1373#atctatcactgtaagatggtatcagagctcatgggctgaaccctagccctcgatccccgttgtccgccggcgctccggcttgccggcggcggctccctatcgggcaaatcttcttcacgtcctcctcgtccggatcagcagcgggattcacagcaagtcagtgtgattcgtccgtcaagcgtgagtgcatcgctcattgcagccgctcgtcacgcggttgctccgctcagccgttgttgctgctcttccactactgctgccgctgtgtgctgctggtgctaattcaggagacaatacatcaagtcctgtaagcaagtctctgtccagtcaatttgtcaaattttcttctgctggtcttgatggcaacatccgacccctttcttggaggtggagctctgctctccacggacattaagctaaatggtcaaaattatcaagaatgagaactttcagctcgtatgcttttgaggtcgattggtcaagcatctcacctcacagatgatcctcctgatgagaaaacggatgcaactaaaattaaggcgtggaaaacagcagatgatcgtgttatgggattcatattcatgagtgtagaggtgcctattcggatgagtttcagggatcacactaccgctaaagagatgtgggactacctcaaacagaggtacactcaagaaagcggagctttgcgtttttccttgctgcagaatttgcacaacttacaacaacaagatcagtccattgaagaattttataatgcctttactcggttgtctggacagcttgaggcacagactccaaaaggtgcttcaggttgtgcacaatgcaaggcgagagagaagcatgatcaagaaaatctagtgtatcaatttgtcatgagactttcctctcaatttgagtccattcgagttcagttgcttggacgtcctacacgtcctactatggcggaggctcttgcagatctaatcgctgaggagacacgtctttgttccttggacactactcctactcctgtggttactcacaatgtcatggcagcacctcagcgtgttggagctcctatgggcgggatccctgaattcagttccatcgccaaaagtgatcgtatttgctctcattgcaagaaggttggacatatttccgatgattgcttctatcttcatccagagaagttggctgattatcaagctaggcgtgcagcggtcccccgtcctcgtgcgacggctagtgctcctgttttcttggatatcactgctgctggtccttctagtactagtgctggtggcagtgcctctagcgccgtctcatgtgctcctcagtcattggttgcaagaccgtcttatcaagccagtgattggtcatggccatcaccatagttggtccccaaggcctctaagtgtgaggtcatcttcgcctaccacttttgttgccatctcctacttgttgcttttgcttgctgtttggagaaaaaggttgttgctgctatagtatatatctgtccttcagttcagttcaagtcttctgttatccattaaatctatctaagtcaatttcatatcttc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053643.1 RefSeq:Os02g0552700]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Revision as of 05:43, 14 May 2015
Please input one-sentence summary here.
Annotated Information
Function
This gene encodes a novel CCHC-type zinc finger pronein called OsZFP6. OsZFP6 is structurally and functionally conserved, mainly localised in nucleus, and can play an important role in stress tolerance responses to salt (NaCl), alkali (NaHCO3), and H2O2 treatment in rice. Functional analysis also showed overexpression of this gene in transgenic Arabidopsis and yeast to NaHCO3 and H2O2.
Fig. 1. OsZFP6 expression after treatment with 150 mM NaCl, 60 mM NaHCO3, or 5 mM H2O2 for 0, 12, 24, and 48 h, respectively. Bars with different letters showed significant differences at P < 0.01 (Means ± SD, n = 6).
Construction
Sequencing results confirmed that the OsZFP6 sequence was identical to Os02g0552700. The OsZFP6 gene is a single-copy gene in the rice genome. It is 1559 bp in length with a 458 bp 5' UTR and a 186 bp 3' UTR. The ORF encodes a 304 amino acid with a molecular weight of 33.6 kDa and an isoelectric point of 7.35. Based on structural properties indicated by the SMART programs, the predicted protein contains two conserved domains: a Pfam retrotrans-gag domain from amino acid 48 to 146 and a ZnF C2HC domain from amino acid 216 to 232.
Expression
Using the online analysis tool Psort to predict the subcellular localisation of rice OsZFP6, OsZFP6 was localised to the nucleus with a 73.9% probability. To validate the predicted result, a PBI121-OsZFP6:GFP plasmid was transformed into onion epidermal cells. After culture for 18-24 h in the dark, green fluorescence was observed in the nucleus (as shown in figure), suggesting the OsZFP6 protein, driven by the 35S promoter, was localized in the nucleus.
Tissue distribution of OsZFP6 gene expression is still unknown yet.
Table 1. Prediction of OsZFP6 subcellular localisation by Psort.
Fig. 2. Subcellular localisation of the 35S::OsZFP6::GFP fusion protein. Merge, green fluorescence and bright field superposition; DIC, bright field.
Evolution
The CysCysHisCys (CCHC)-type zinc finger domains contain the sequence C-X2-C-X4-H-X4-C, where X can be any amino acid, and the numbers indicate the number of residues. This domain is conserved in Arabidopsis, yeast and rice, as shown in table.
Table 2.Conserved C2HC domain in Arabidopsis, yeast, and rice.
Labs working on this gene
Northeast Institute of Geography and Agroecology, Key Laboratory of Soybean Molecular Design Breeding, Chinese Academy of Sciences, Harbin, Heilongjiang 150081, China.
References
Guan QJ, Wang LF, Bu QY, Wang ZY. (2014) The rice gene OsZFP6 functions in multiple stress tolerance responses in yeast and Arabidopsis. Plant Physiol Bioch 82: 1-8.
Structured Information