Difference between revisions of "Os02g0618400"

From RiceWiki
Jump to: navigation, search
(Function)
(Structured Information)
 
(2 intermediate revisions by one other user not shown)
Line 36: Line 36:
 
===Evolution===
 
===Evolution===
 
OsMPS is classified as an R2R3-type MYB TF belonging to clade C14, which includes AtMYB71, AtMYB79 and AtMYB121 from Arabidopsis and two uncharacterized rice MYB TFs. Using the web tool Phytozome (Goodsteinet al.,2012), homologous proteins from Sorghum bicolor, Zea mays and Setaria italica were identified and shown to share high sequence identity with OsMPS at the DNA-binding domain.
 
OsMPS is classified as an R2R3-type MYB TF belonging to clade C14, which includes AtMYB71, AtMYB79 and AtMYB121 from Arabidopsis and two uncharacterized rice MYB TFs. Using the web tool Phytozome (Goodsteinet al.,2012), homologous proteins from Sorghum bicolor, Zea mays and Setaria italica were identified and shown to share high sequence identity with OsMPS at the DNA-binding domain.
 +
 +
===Mutation===
 +
OsMPS mis-expression causes metabolic changes related to growth
 +
 +
In OsMPS overexpression plants, a low level of the tricarboxylic acid cycle intermediates 2–oxoglutarate, malate and fumarate was observed, and these intermediates are directly linked to plant development as their abundance is a potential growth signal. Metabolic profiling revealed that OsMPS over-expression results in accumulation of amino acids and decreased levels of tricarboxylic acid cycle intermediates, which may indicate a lower rate of protein synthesis and metabolism, correlating with the smaller plant size observed.
  
 
===Localization===  
 
===Localization===  
Line 53: Line 58:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os02g0618400|
 
Description = Similar to Snapdragon myb protein 305 homolog|
 
Version = NM_001053984.1 GI:115447338 GeneID:4330001|
 
Length = 2071 bp|
 
Definition = Oryza sativa Japonica Group Os02g0618400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:25438318..25440388|
 
CDS = 25438710..25439307,25439416..25439545,25440127..25440268|
 
GCID = <gbrowseImage1>
 
name=NC_008395:25438318..25440388
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:25438318..25440388
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggaagggcagcagttcgcttggggaagggaggagggagggtggaggaaagggccatggacagcgcaggaagacaagctgctggttgagtacgtgaggcagcacggcgaagggaggtggaattctgtcgccaagatcacaggtctgaagagaagtggcaagagctgcaggcttcgttgggtgaactacctgagacctgacctcaagcgaggcaagatcacgccacaggaggagagcgtcatactcgagcttcatgccttgtggggaaacaggtggtcgacgatcgcgcgtagcctgcctggcaggacggacaacgagatcaagaactactggaggacgcacttcaagaagggcaagccgtccaagaacatcgagcgcgcgagggctcggttcctgaagcagcgccgcgagatgcagcagcagagccagctgatgcaaaccggccagcagcagcagctcggccaagacgacgacgccaccagcgcggtggtggacgacaaccttgcggaggtcgcgccaccagccgccacctcgctgacccacgacggcgagctccagataatgcaggagatggcgccggacatggacgacctgctgtactaccacccgggagacatgtcgccctattcctacgacgacctcctcggcagcggcggcggcgagtgcggcgccgtggcggccagcgctggcgctgccgcctcgacgagcgagggctcaagcgaggagctcgacggcggcgccgccacgtggggcagcctgtggaacctcgacgacgtggtgcacgacatgatgatcgactgcgccgccggcgccggctgctgctggggtagcttccctccgctacaggataaaggcctcgctttctactag</cdnaseq>|
 
AA = <aaseq>MEGQQFAWGREEGGWRKGPWTAQEDKLLVEYVRQHGEGRWNSVA                    KITGLKRSGKSCRLRWVNYLRPDLKRGKITPQEESVILELHALWGNRWSTIARSLPGR                    TDNEIKNYWRTHFKKGKPSKNIERARARFLKQRREMQQQSQLMQTGQQQQLGQDDDAT                    SAVVDDNLAEVAPPAATSLTHDGELQIMQEMAPDMDDLLYYHPGDMSPYSYDDLLGSG                    GGECGAVAASAGAAASTSEGSSEELDGGAATWGSLWNLDDVVHDMMIDCAAGAGCCWG                    SFPPLQDKGLAFY</aaseq>|
 
DNA = <dnaseqindica>1082..1679#844..973#121..262#atcgatcgcttcatcactcgctagctcatcactgcgagcggagacagctcaggagggaggaagcaaaagaagagagagagagatcaagagatagacgaagagatttgtctgtgtaaatcaatggaagggcagcagttcgcttggggaagggaggagggagggtggaggaaagggccatggacagcgcaggaagacaagctgctggttgagtacgtgaggcagcacggcgaagggaggtggaattctgtcgccaagatcacaggtaggtgctatagctactgattgagtggtgttcttgcatgttcgtgaccatttcgatgttctctcgcacgttgtcccaaatcaagaagctcgatatatatagccttttaggaagaaattatagctagtagcatcagtttgcatttggtttgttaaattgcacgttggggcagtcaaacatgcaattagtacatgtttaaggttgcatatgtcgcccatgattgtcaagttgcatgatttgattccaattgcggcatttggtacgatcgtgttttcggagaataggcatttggtgcttgctctagcacatgcattaattaattaaaccgcgtatgaactgcatgcacgcgcgtgtaaattcgtcagaaccttttcctagctgtaaccgtggaaatccttttcctagctgagagttagcttcagatgattagcattaaccaagctttactttcttagttaagtacaaatgggagtggtaggtgtgtcatgtacatgttactttttctgcatatgtacgtcagctaattctgtctgatgctatgtatcttacagtactgagcctgtgtatgtcgtgctttgcaggtctgaagagaagtggcaagagctgcaggcttcgttgggtgaactacctgagacctgacctcaagcgaggcaagatcacgccacaggaggagagcgtcatactcgagcttcatgccttgtggggaaacaggtaacaacccatttgcaaatcctttcgtgatcgagctcgatcgcgtttaattttgccatgaatgtgtaactgattcgatcgatcgcattattctctgtggcggtgtaggtggtcgacgatcgcgcgtagcctgcctggcaggacggacaacgagatcaagaactactggaggacgcacttcaagaagggcaagccgtccaagaacatcgagcgcgcgagggctcggttcctgaagcagcgccgcgagatgcagcagcagagccagctgatgcaaaccggccagcagcagcagctcggccaagacgacgacgccaccagcgcggtggtggacgacaaccttgcggaggtcgcgccaccagccgccacctcgctgacccacgacggcgagctccagataatgcaggagatggcgccggacatggacgacctgctgtactaccacccgggagacatgtcgccctattcctacgacgacctcctcggcagcggcggcggcgagtgcggcgccgtggcggccagcgctggcgctgccgcctcgacgagcgagggctcaagcgaggagctcgacggcggcgccgccacgtggggcagcctgtggaacctcgacgacgtggtgcacgacatgatgatcgactgcgccgccggcgccggctgctgctggggtagcttccctccgctacaggataaaggcctcgctttctactagctatagcttaacgattactaaattgctagctagctatagctacaagcctacacactctacaagtagatgttccttttggtcttgtgcatcgatccaaactgatagcacacagcagcctgtgcgtgtggaggaggtcacacgtagtgactatgcaggtgagagcgagaggccattttgtgtacacgaagtgttggtggataaggatgcaacaccaactatactccactttgagtagctagctcgcctcgatggcatgtttggctcatttgagagcgctttttctaggagaaaaaggaagggaagagtttttttctttgttttgcttttggagaaagaatataggaggactgcaggggggaaaatcaggtgttaaaagtgcatctgagctcttg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053984.1 RefSeq:Os02g0618400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 05:45, 14 May 2015

OsMPS, an R2R3-type MYB transcription factor of rice, is induced by salt stress and expressed in vegetative and reproductive tissues. In all, OsMPS is required for the adaptive growth response in rice during adverse environmental conditions.

Annotated Information

Function

1.OsMPS affects plant growth OsMPS is a direct regulator of genes encoding expansins, and it may function as a hub for multiple hormones to control plant growth. OsMPS overexpression plants were severely reduced in size under control conditions, and we find that seedlings overexpress ing OsMPS was significantly less affected by salt stress than in EV seedings.(Figure4) In a word,in the absence of stress, knockdown of OsMPS increased biomass accumulation, while OsMPS overexpression impaired growth.

2.OsMPS affects heading date and panicle-related traits OsMPS is expressed in anthers and spikelets, suggesting a role in reproductive development. OE6–2 plants showed a delay in heading and flowering by 21 days, and a reduced number of panicles per plant compared to the EV line.( Figure5) Down-regulation of OsMPScaused early heading and flowering.

3. OsMPS modulates the expression of hormone and cell wall-related genes OsMPS negatively regulates the expression of several ARF and IAA genes. Interestingly, the growth inhibition of OsMPS over-expression lines was partially rescued by low concentrations of exogenous auxin. OsMPS acts as a negative regulator of auxin related genes and cell wall-remodeling genes. BR biosynthesis and signaling genes were found to be down-regulated upon over-expression of OsMPS.

4.OsMPS affects the cell size and length of leaf epidermal cells


Figure4.jpg

Figure5.jpg

Figure4'.jpg

Expression

OsMPS is expressed in most tissues, including shoots, roots, anthers and seeds, but not in endosperm, stigma, ovary or the embryo. (Figure2') OsMPS is expressed in anthers and spikelets, suggesting a role in reproductive development. However, Over-expression of OsMPS resulted in decreased plant stature at the seedling, vegetative and heading stage.(Figure3')

After salt stress induction, OsMPS can express in 30 min and 1 h , and Up-regulation of OsMPS was also observed in leaves after salt stress.(Figure1') Moreover, OsMPS expression is modulated by multiple hormones, Auxin, BL and GA, which are known to promote cell elongation (Depuydt and Hardtke, 2011), transiently decrease the expression of OsMPS.

Figure1'.jpg

Figure2'.jpg

Figure3'.jpg


Evolution

OsMPS is classified as an R2R3-type MYB TF belonging to clade C14, which includes AtMYB71, AtMYB79 and AtMYB121 from Arabidopsis and two uncharacterized rice MYB TFs. Using the web tool Phytozome (Goodsteinet al.,2012), homologous proteins from Sorghum bicolor, Zea mays and Setaria italica were identified and shown to share high sequence identity with OsMPS at the DNA-binding domain.

Mutation

OsMPS mis-expression causes metabolic changes related to growth

In OsMPS overexpression plants, a low level of the tricarboxylic acid cycle intermediates 2–oxoglutarate, malate and fumarate was observed, and these intermediates are directly linked to plant development as their abundance is a potential growth signal. Metabolic profiling revealed that OsMPS over-expression results in accumulation of amino acids and decreased levels of tricarboxylic acid cycle intermediates, which may indicate a lower rate of protein synthesis and metabolism, correlating with the smaller plant size observed.

Localization

OsMPS contains a putative nuclear localization signal immediately downstream of the R2R3 domain, so it locates in the nucleus.

Labs working on this gene

Institute of Biochemistry and Biology, University of Potsdam, Karl Liebknecht Straße 24-25, Haus 20, 14476 Potsdam, Germany

Max Planck Institute of Molecular Plant Physiology, Am M€ uhlenberg 1, 14476 Potsdam, Germany

References

1.Romy Schmidt, Jos H. M. Schippers, Delphine Mieulet et al.(2013) MULTIPASS, a rice R2R3-type MYB transcription factor, regulates adaptive growth by integrating multiple hormonal pathways. The Plant Journal 76,258–273

2.Chaves, M.M., Flexas, J. and Pinheiro, C.(2009) Photosynthesis under drought and salt stress: regulation mechanisms from whole plant to cell. Ann. Bot.103, 551–560.

3.Achard, P., Cheng, H., De Grauwe, L., Decat, J., Schoutteten, H., Moritz, T.,Van Der Straeten, D., Peng, J. and Harberd, N.P.(2006) Integration of plant responses to environmentally activated phytohormonal signals. Science, 311,91–94

Structured Information