Difference between revisions of "Os02g0787300"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Structured Information)
 
(11 intermediate revisions by one other user not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
  
RAI1 gene is up-regulated in suspension cells expressing a constitutively active form of OsRac1. RAI1 encodes a putative basic helix-loop-helix transcription factor. RAI1 could be regulated by OsRac1 through an OsMAPK3/6 cascade. RAI1 as the first transcription factor acting downstream of OsRac1.
+
===Function===
 +
RAI1 gene is up-regulated in suspension cells expressing a constitutively active form of OsRac1. RAI1 encodes a putative basic helix-loop-helix transcription factor. RAI1 is involved in defense responses in rice.RAI1 interacted with OsMAPK3 and OsMAPK6 proteins in vivo and in vitro.  RAI1 was phosphorylated by OsMAPK3/6 and OsMKK4-dd in vitro. RAI1 could be regulated by OsRac1 through an OsMAPK3/6 cascade. RAI1 as the first transcription factor acting downstream of OsRac1.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
RAI1 localized in cytoplasm and nucleus.
 +
OsMAPK6 and OsMAPK3 together with OsMKK4-dd can regulate the downstream genes of RAI1 and phosphorylate RAI1 proteins. Therefore,regulation of
 +
downstream genes by RAI1 could be accomplished by changes in both its transcription level and post-translationally through an OsMKK4–OsMAPK3/6 cascade.
  
 
===Evolution===
 
===Evolution===
Line 14: Line 17:
  
  
 
+
===Labs working on this gene===
 
Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, 630-0192 Japan
 
Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, 630-0192 Japan
  
== Headline text ==
 
 
Graduate School of Agriculture and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo, 113-0032 Japan
 
Graduate School of Agriculture and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo, 113-0032 Japan
== Headline text ==
+
 
 
Agricultural and Veterinary Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama, 222-8567 Japan
 
Agricultural and Veterinary Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama, 222-8567 Japan
== Headline text ==
+
 
 
Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan
 
Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan
  
 
+
===References===
 
Sung-Hyun Kim;Tetsuo Oikawa;Junko Kyozuka;Hann Ling Wong;Kenji Umemura;Mitsuko Kishi-Kaboshi;Akira Takahashi;Yoji Kawano;Tsutomu Kawasaki;Ko Shimamoto
 
Sung-Hyun Kim;Tetsuo Oikawa;Junko Kyozuka;Hann Ling Wong;Kenji Umemura;Mitsuko Kishi-Kaboshi;Akira Takahashi;Yoji Kawano;Tsutomu Kawasaki;Ko Shimamoto
  The bHLH Rac Immunity1 (RAI1) Is Activated by OsRac1 via OsMAPK3 and OsMAPK6 in Rice Immunity
+
The bHLH Rac Immunity1 (RAI1) Is Activated by OsRac1 via OsMAPK3 and OsMAPK6 in Rice Immunity
 
   Plant and Cell Physiology, 2012, 53(4): 740-754
 
   Plant and Cell Physiology, 2012, 53(4): 740-754
 +
 +
 +
===Figure===
 +
[[File:pathway.jpg]]
 +
 +
 +
Proposed model of the OsRac1 signaling pathway. In this model, the rice chitin receptor OsCERK1, which is present at the plasma membrane with the OsRac1 complex (Chen et al. 2010), is activated by exposure to PAMPs such as chitin. This is rapidly followed by the activation of OsRac1 (A. Akamatsu et al. unpublished data).The active form of OsRac1 interacts with OsMAPK3 and OsMAPK6 via the activation of OsMKK4 (Figs. 5, 6) (Lieberherr et al. 2005). The
 +
activated forms of OsMAPK3 and OsMAPK6 interact with RAI1 in the cytoplasm and the nucleus. In the nucleus, the phosphorylated (or unphosphorylated) form of RAI1 functions as a transcription factor to regulate the expression of downstream genes such as PAL1 and OsWRKY19.
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os02g0787300|
 
Description = Similar to MAP kinase kinase|
 
Version = NM_001054876.1 GI:115449122 GeneID:4330957|
 
Length = 1879 bp|
 
Definition = Oryza sativa Japonica Group Os02g0787300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:34328931..34330809|
 
CDS = 34329593..34330807|
 
GCID = <gbrowseImage1>
 
name=NC_008395:34328931..34330809
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:34328931..34330809
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>ctgcccccgatcggcctcgtcctctccacgccgcgagcccaccagaaaacgcacacgccgacgcgagccaatcaacccgccgcgccgcgcctcgccgccgtcgcgatgcgaccgggcgggccgccgagcttgcgggcggggctgcagcagcagcagcagcagcagccggggacgccggggaggtcgcggcgccggccggatctcacgctgccgctgccgcagcgggacctcacgtcgctcgcggtgccgctgccgctgccgctgccgccgtcgtcggcgccgtcgtcgacgtcgtcgtccgggtcgtcctcgctcggcggcgtgcccaccccgccgaattcggtcggctccgcgccgccggccccgccgccgctgtcggagctggagcgcgtccgccgcatcgggagcggcgcgggcgggacggtgtggatggtgcggcaccgccccacggggcggccgtacgcgctcaaggtgctctacgggaaccacgacgacgccgtgcggcggcagatcacgcgcgagatcgcgatcctccgcaccgccgagcacccggccgtcgtgcggtgccacggcatgtacgagcaggccggcgagctccagatcctgctcgagtacatggacgggggatccctcgagggccgccgcatcgcctccgaggccttcctcgccgacgtcgcgcgccaggtgctctccgggatcgcctacctccaccgccgccacatcgtccaccgcgacatcaagccatccaacctcctcatcgactccggccgccgcgtcaagatcgccgacttcggcgtcggccgcatcctcaaccagaccatggacccctgcaactcctccgtcgggaccatcgcctacatgagccccgagcgcatcaacaccgacctcaacgacggcgcctacgacggctacgccggcgacatctggagcttcggcctgagcattctcgagttctacatgggcaggttccccctcggggagaatctcggcaagcagggagactgggccgccctcatgtgcgcgatttgctactccgactcgccggcgccgccgcccaacgcctcgccggagttcaagagcttcatcagctgctgcctccagaagaacccggcgcggcggccatcggcggcgcagcttctccaacatcggttcgtcgccgggccacagcagcagcagcagccgcagccgcagcccctcgcaccgcctccgtcatga</cdnaseq>|
 
AA = <aaseq>LPPIGLVLSTPRAHQKTHTPTRANQPAAPRLAAVAMRPGGPPSL                    RAGLQQQQQQQPGTPGRSRRRPDLTLPLPQRDLTSLAVPLPLPLPPSSAPSSTSSSGS                    SSLGGVPTPPNSVGSAPPAPPPLSELERVRRIGSGAGGTVWMVRHRPTGRPYALKVLY                    GNHDDAVRRQITREIAILRTAEHPAVVRCHGMYEQAGELQILLEYMDGGSLEGRRIAS                    EAFLADVARQVLSGIAYLHRRHIVHRDIKPSNLLIDSGRRVKIADFGVGRILNQTMDP                    CNSSVGTIAYMSPERINTDLNDGAYDGYAGDIWSFGLSILEFYMGRFPLGENLGKQGD                    WAALMCAICYSDSPAPPPNASPEFKSFISCCLQKNPARRPSAAQLLQHRFVAGPQQQQ                    QPQPQPLAPPPS</aaseq>|
 
DNA = <dnaseqindica>3..1217#ccctgcccccgatcggcctcgtcctctccacgccgcgagcccaccagaaaacgcacacgccgacgcgagccaatcaacccgccgcgccgcgcctcgccgccgtcgcgatgcgaccgggcgggccgccgagcttgcgggcggggctgcagcagcagcagcagcagcagccggggacgccggggaggtcgcggcgccggccggatctcacgctgccgctgccgcagcgggacctcacgtcgctcgcggtgccgctgccgctgccgctgccgccgtcgtcggcgccgtcgtcgacgtcgtcgtccgggtcgtcctcgctcggcggcgtgcccaccccgccgaattcggtcggctccgcgccgccggccccgccgccgctgtcggagctggagcgcgtccgccgcatcgggagcggcgcgggcgggacggtgtggatggtgcggcaccgccccacggggcggccgtacgcgctcaaggtgctctacgggaaccacgacgacgccgtgcggcggcagatcacgcgcgagatcgcgatcctccgcaccgccgagcacccggccgtcgtgcggtgccacggcatgtacgagcaggccggcgagctccagatcctgctcgagtacatggacgggggatccctcgagggccgccgcatcgcctccgaggccttcctcgccgacgtcgcgcgccaggtgctctccgggatcgcctacctccaccgccgccacatcgtccaccgcgacatcaagccatccaacctcctcatcgactccggccgccgcgtcaagatcgccgacttcggcgtcggccgcatcctcaaccagaccatggacccctgcaactcctccgtcgggaccatcgcctacatgagccccgagcgcatcaacaccgacctcaacgacggcgcctacgacggctacgccggcgacatctggagcttcggcctgagcattctcgagttctacatgggcaggttccccctcggggagaatctcggcaagcagggagactgggccgccctcatgtgcgcgatttgctactccgactcgccggcgccgccgcccaacgcctcgccggagttcaagagcttcatcagctgctgcctccagaagaacccggcgcggcggccatcggcggcgcagcttctccaacatcggttcgtcgccgggccacagcagcagcagcagccgcagccgcagcccctcgcaccgcctccgtcatgatgaattccgatgggattccggcgttgatccggctcggccatggatggacggtggtttggcattgagacgtgggatctaggagtgctcttcctagccattttgggtattcaagccaccaccacaatttagtgatttaccctcatcatcatcccctctcttgtcgctgttgctcctggaattaagctcctctcctctcctccccttcccctcctcaacttttctttaatctcttcttcttcttttttttcttcttcttcttccaattaagttcatgttcttccaaatgatcatcatataatatgggttgttaagaaagcaatttcttcttaattaatttattttctaaaatcatcattggagcagtagaagtagtagtagtagtaggtggtggtgtccatctgctccagttgcaggaggaggaggagaagatggtgacaaaacaacattgtgatgctttgctgtgctggcttcttggattctgcaaattgtggggggtggattggattggattggatggatcatgaatggttggagcaagcaaatcttgaaatgggaaccaaatcaactttattttttcctcctcctcttcctgaatcctgatcctttctctctggtggttttgaggggagaatgatcgaatgaaatcatgaattgctctcttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054876.1 RefSeq:Os02g0787300]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 06:01, 14 May 2015

Please input one-sentence summary here.

Annotated Information

Function

RAI1 gene is up-regulated in suspension cells expressing a constitutively active form of OsRac1. RAI1 encodes a putative basic helix-loop-helix transcription factor. RAI1 is involved in defense responses in rice.RAI1 interacted with OsMAPK3 and OsMAPK6 proteins in vivo and in vitro. RAI1 was phosphorylated by OsMAPK3/6 and OsMKK4-dd in vitro. RAI1 could be regulated by OsRac1 through an OsMAPK3/6 cascade. RAI1 as the first transcription factor acting downstream of OsRac1.

Expression

RAI1 localized in cytoplasm and nucleus. OsMAPK6 and OsMAPK3 together with OsMKK4-dd can regulate the downstream genes of RAI1 and phosphorylate RAI1 proteins. Therefore,regulation of downstream genes by RAI1 could be accomplished by changes in both its transcription level and post-translationally through an OsMKK4–OsMAPK3/6 cascade.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.


Labs working on this gene

Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, 630-0192 Japan

Graduate School of Agriculture and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo, 113-0032 Japan

Agricultural and Veterinary Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama, 222-8567 Japan

Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan

References

Sung-Hyun Kim;Tetsuo Oikawa;Junko Kyozuka;Hann Ling Wong;Kenji Umemura;Mitsuko Kishi-Kaboshi;Akira Takahashi;Yoji Kawano;Tsutomu Kawasaki;Ko Shimamoto

The bHLH Rac Immunity1 (RAI1) Is Activated by OsRac1 via OsMAPK3 and OsMAPK6 in Rice Immunity
 Plant and Cell Physiology, 2012, 53(4): 740-754


Figure

Pathway.jpg


Proposed model of the OsRac1 signaling pathway. In this model, the rice chitin receptor OsCERK1, which is present at the plasma membrane with the OsRac1 complex (Chen et al. 2010), is activated by exposure to PAMPs such as chitin. This is rapidly followed by the activation of OsRac1 (A. Akamatsu et al. unpublished data).The active form of OsRac1 interacts with OsMAPK3 and OsMAPK6 via the activation of OsMKK4 (Figs. 5, 6) (Lieberherr et al. 2005). The activated forms of OsMAPK3 and OsMAPK6 interact with RAI1 in the cytoplasm and the nucleus. In the nucleus, the phosphorylated (or unphosphorylated) form of RAI1 functions as a transcription factor to regulate the expression of downstream genes such as PAL1 and OsWRKY19.

Structured Information