Difference between revisions of "Os02g0100100"

From RiceWiki
Jump to: navigation, search
(References)
 
(4 intermediate revisions by one other user not shown)
Line 19: Line 19:
 
The typical PDI is the most prominent member of a family of related PDI-like proteins characterised by the presence of one to three thioredoxin-like active domains<ref name="ref8" />. Several genes encoding PDI-like proteins with unusual primary structure, different expression pattern and exhibiting a wide range of activities have been identified in every extensively sequenced mammalian genome<ref name="ref9" />. Even though all proteins of the PDI family have been located within the ER, where they perform their function, Turano et al. have located some of them in different subcellular locations, but their export mechanism is still unknown. In higher plants, 13 genes have been identified in Arabidopsis (Arabidopsis thaliana) and 12 in rice (Oryza sativa) and in maize (Zea mays) <ref name="ref10" />.
 
The typical PDI is the most prominent member of a family of related PDI-like proteins characterised by the presence of one to three thioredoxin-like active domains<ref name="ref8" />. Several genes encoding PDI-like proteins with unusual primary structure, different expression pattern and exhibiting a wide range of activities have been identified in every extensively sequenced mammalian genome<ref name="ref9" />. Even though all proteins of the PDI family have been located within the ER, where they perform their function, Turano et al. have located some of them in different subcellular locations, but their export mechanism is still unknown. In higher plants, 13 genes have been identified in Arabidopsis (Arabidopsis thaliana) and 12 in rice (Oryza sativa) and in maize (Zea mays) <ref name="ref10" />.
  
===Evolution===
+
==Structured Information==
Please input evolution information here.
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 38: Line 36:
 
<ref name="ref8">Ellgaard L, Ruddock LW: The human protein disulphide isomerase family: substrate interactions and functional properties. EMBO Rep 2005, 6:28-32.</ref>
 
<ref name="ref8">Ellgaard L, Ruddock LW: The human protein disulphide isomerase family: substrate interactions and functional properties. EMBO Rep 2005, 6:28-32.</ref>
 
<ref name="ref9">Turano C, Coppari S, Altieri F, Ferraro A: Proteins of the PDI family: unpredicted non-ER locations and functions. J Cell Physiol 2002,193:154-163.</ref>
 
<ref name="ref9">Turano C, Coppari S, Altieri F, Ferraro A: Proteins of the PDI family: unpredicted non-ER locations and functions. J Cell Physiol 2002,193:154-163.</ref>
<ref name="ref10"></ref>
+
<ref name="ref10">Houston NL, Fan C, Xiang QY, Schulze JM, Jung R, Boston RS: Phylogenetic analyses identify 10 classes of the protein disulfide isomerase family in
 +
plants, including single-domain protein disulfide isomerase-related proteins. Plant Physiol 2005, 137:762-778.</ref>
 
</references>
 
</references>
  

Latest revision as of 06:23, 14 May 2015

Please input one-sentence summary here.

Annotated Information

Function

Protein disulfide isomerase or PDI is an enzyme in the endoplasmic reticulum in eukaryotes that catalyzes the formation and breakage of disulfide bonds between cysteine residues within proteins as they fold.[1][2][3] Please input function information here.

Protein folding

PDI contains four thioredoxin-like domains, two of which retain the canonical CXXC motif. The reduced (that is, dithiol) form of PDI is able to catalyse a reduction of mispaired thiol residues of a particular substrate, acting as an isomerase.[4] Therefore, PDI is capable of catalyzing the posttranslational modification disulfide exchange. Such exchange reactions can occur intramolecularly, leading to the rearrangement of disulfide bonds in a single protein.[5]

Redox signaling

In the chloroplasts of the unicellular algae Chlamydomonas reinhardtii the PDI RB60 serves as a redox sensor component of an mRNA-binding protein complex implicated in the photo-regulation of the translation of psbA, the RNA encoding for the photosystem II core protein D1. PDI has also been suggested to play a role in the formation of regulatory disulfide bonds in chloroplasts.[6]

Other functions

PDI helps load antigenic peptides into MHC class I molecules. These molecules (MHC I) are related to the peptide presentation by antigen-presenting cells in the immune response.

PDI has been found to be involved in the breaking of bonds on the HIV gp120 protein during HIV infection of CD4 positive cells, and is required for HIV infection of lymphocytes and monocytes.[7]

Expression

The typical PDI is the most prominent member of a family of related PDI-like proteins characterised by the presence of one to three thioredoxin-like active domains[8]. Several genes encoding PDI-like proteins with unusual primary structure, different expression pattern and exhibiting a wide range of activities have been identified in every extensively sequenced mammalian genome[9]. Even though all proteins of the PDI family have been located within the ER, where they perform their function, Turano et al. have located some of them in different subcellular locations, but their export mechanism is still unknown. In higher plants, 13 genes have been identified in Arabidopsis (Arabidopsis thaliana) and 12 in rice (Oryza sativa) and in maize (Zea mays) [10].

Structured Information

Labs working on this gene

Please input related labs here.

References

  1. Wilkinson B, Gilbert HF (June 2004). "Protein disulfide isomerase". Biochimica et Biophysica Acta 1699 (1-2): 35–44.
  2. Gruber CW, Cemazar M, Heras B, Martin JL, Craik DJ (August 2006). "Protein disulfide isomerase: the structure of oxidative folding". Trends in Biochemical Sciences 31 (8): 455–64.
  3. Galligan JJ, Petersen DR (July 2012). "The human protein disulphide isomerase gene family". Human Genomics 6 (6).
  4. Hatahet F, Ruddock LW (October 2007). "Substrate recognition by the protein disulfide isomerases". FEBS J. 274 (20): 5223–34.
  5. Hatahet F, Ruddock LW (November 2009). "Protein Disulfide Isomerase: A Critical Evaluation of Its Function in Disulfide Bond Formation". Antioxidants & Redox Signaling. 11 (11): 2807–50.
  6. Wittenberg G, Danon A (2008). "Disulfide bond formation in chloroplasts". Plant Science 175 (4): 459–466.
  7. Ryser, Hugues J.-P.; Flückiger, Rudolf (August 2005). "Progress in targeting HIV-1 entry". Drug Discovery Today. Keynote review 10 (16) (Elsevier). pp. 1085–1094.
  8. Ellgaard L, Ruddock LW: The human protein disulphide isomerase family: substrate interactions and functional properties. EMBO Rep 2005, 6:28-32.
  9. Turano C, Coppari S, Altieri F, Ferraro A: Proteins of the PDI family: unpredicted non-ER locations and functions. J Cell Physiol 2002,193:154-163.
  10. Houston NL, Fan C, Xiang QY, Schulze JM, Jung R, Boston RS: Phylogenetic analyses identify 10 classes of the protein disulfide isomerase family in plants, including single-domain protein disulfide isomerase-related proteins. Plant Physiol 2005, 137:762-778.

Structured Information

Gene Name

Os02g0100100

Description

Protein disulphide isomerase family protein

Version

NM_001052114.1 GI:115443598 GeneID:4327971

Length

4744 bp

Definition

Oryza sativa Japonica Group Os02g0100100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:3634..8377

Sequence Coding Region

3864..4049,4861..4917,5514..5648,5728..5808,5884..5952
,6419..6493,6619..6705,6873..6953,7045..7163
,7262..7430,7538..7667,7753..8255

Expression

GEO Profiles:Os02g0100100

Genome Context

<gbrowseImage1> name=NC_008395:3634..8377 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:3634..8377 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcgctcccgatctctcctcctcgtcgccctcgccacccttcttctccacgcctccgcctccgcctccgacgacgacctcgactacctcatcgacaacgccgacgacatccccgccaacgaccccgacggctggctccaggagggctcccccgacgacgacgacgacgacgacctcttccaccatggccaggcccaggaccatcccatagatgagacccacgtcttcctcctctccgccgccaacttctccgacttcctcgcctcccaccgccatgtcatggtcgagttctacgccccctggtgcgcccattgccaggcgctcgccccagactacgccgccgccgccgccgacctctcccctcttgcccatcaagtcgccctcgccaaggtcgacgccaccgaggacactgatctcgcccagaagtacgacgtccagggcttccccaccatcctcttcttcatcgacggcgttcccaaggactacaacggcgcaagaaccaaggaagccatcgtgtcgtgggtcaacaagaagctagctcccggggtgcaaaacatcaccaccgtcgacgaggcggagaagatactcaccggggaggacaaggccattcttgccgtcctcgactccctatcgggtgctcacagtgatgagattgctgctgcttcgaggctggaagatgctatcaacttttaccagacttccaatcctgatgttgccaagctttttcaccttgacccagcggccaagcgcccgtccttagtcctgctcaagaaacaagaggaggagaagttgaccttctatgatgggccattcaaagcatctgcaattgccgattttgtatctgcaaacaagcttccgttggtcaacaccctcacacaggaaactgctccttccatttttgacaatccaatcaagaagcagattttactatttgttgttgcaaacgaatcgtcgaaatttctgcccatctttaaggaagcatcaaaatcattcaaggggaagcttttgtttgtctttgtggagcgtgacaatgaggaagtaggtgaaccagttgccaactactttggtattactggacaagagaccacagttcttgcttacactgggaatgaagatgctaggaattttttccttgatggtgaaatatcggtagagaatattaagagatttgctgaggatttcttagaggaaaagctcacaccgttctacaagtctgaacctgtacctgaatctaatgaaggagatgtcaaaattgttgttggaaaaaacctagatcagattgttttggatgaatcaaaagatgcccttttggagatatatgcaccatggtgtgggcattgtcaggaactggagcctacctacaacaagctaggaaagcatctccgtggcattgactcccttgtaatagctaaaatggatggcactgccaatgagcatccacgtgcaaagcctgatggattcccaacgatcctcttttatccagcaggaaagaaaagttttgagcctattacttttgagggggaccgtacggtggtggagatgtacaagtttatcaagaagcacgctagcatccctttcaaactgaagcggccggattcgtcagcaacgaaaacagagaaggatcagagcacagcttcaactaatttgaggggggagaggagttccggtacaaatttcaaggatgagttgtag</cdnaseq>

Protein Sequence

<aaseq>MRSRSLLLVALATLLLHASASASDDDLDYLIDNADDIPANDPDG WLQEGSPDDDDDDDLFHHGQAQDHPIDETHVFLLSAANFSDFLASHRHVMVEFYAPWC AHCQALAPDYAAAAADLSPLAHQVALAKVDATEDTDLAQKYDVQGFPTILFFIDGVPK DYNGARTKEAIVSWVNKKLAPGVQNITTVDEAEKILTGEDKAILAVLDSLSGAHSDEI AAASRLEDAINFYQTSNPDVAKLFHLDPAAKRPSLVLLKKQEEEKLTFYDGPFKASAI ADFVSANKLPLVNTLTQETAPSIFDNPIKKQILLFVVANESSKFLPIFKEASKSFKGK LLFVFVERDNEEVGEPVANYFGITGQETTVLAYTGNEDARNFFLDGEISVENIKRFAE DFLEEKLTPFYKSEPVPESNEGDVKIVVGKNLDQIVLDESKDALLEIYAPWCGHCQEL EPTYNKLGKHLRGIDSLVIAKMDGTANEHPRAKPDGFPTILFYPAGKKSFEPITFEGD RTVVEMYKFIKKHASIPFKLKRPDSSATKTEKDQSTASTNLRGERSSGTNFKDEL</aaseq>

Gene Sequence

<dnaseqindica>4329..4514#3461..3517#2730..2864#2570..2650#2426..2494#1885..1959#1673..1759#1425..1505#1215..1333#948..1116#711..840#123..625#gctcttatcgaaaattaaaaaaagagagagaaataaaaggggatcgatccgctcttgtagttgtagagcgttccattccacttccacagcagtggactcagtgagcaacggaggaagcaacgatgcgctcccgatctctcctcctcgtcgccctcgccacccttcttctccacgcctccgcctccgcctccgacgacgacctcgactacctcatcgacaacgccgacgacatccccgccaacgaccccgacggctggctccaggagggctcccccgacgacgacgacgacgacgacctcttccaccatggccaggcccaggaccatcccatagatgagacccacgtcttcctcctctccgccgccaacttctccgacttcctcgcctcccaccgccatgtcatggtcgagttctacgccccctggtgcgcccattgccaggcgctcgccccagactacgccgccgccgccgccgacctctcccctcttgcccatcaagtcgccctcgccaaggtcgacgccaccgaggacactgatctcgcccagaagtacgacgtccagggcttccccaccatcctcttcttcatcgacggcgttcccaaggactacaacggcgcaagaaccaagtgcgtgtcccccctccccccagatcccatctcatctcgtctcttggcttcaatttctttgacttgtctcttgccttggctccagggaagccatcgtgtcgtgggtcaacaagaagctagctcccggggtgcaaaacatcaccaccgtcgacgaggcggagaagatactcaccggggaggacaaggccattcttgccgtcctcgactccctatcggtaccttctcttctcttctactcaagtcaaccccgatgctctttctaaattcttactgcacacacactattattattaatcttcttttcaaaccctactacttacagggtgctcacagtgatgagattgctgctgcttcgaggctggaagatgctatcaacttttaccagacttccaatcctgatgttgccaagctttttcaccttgacccagcggccaagcgcccgtccttagtcctgctcaagaaacaagaggaggagaagttgaccttctatggtacccttctctctaagtcactttaagcatcaatcccctcatttctattttccatgcggggcttggttgttggataatatactccacctatcatgcagatgggccattcaaagcatctgcaattgccgattttgtatctgcaaacaagcttccgttggtcaacaccctcacacaggaaactgctccttccatttttgacaatccaatcaagaagcaggcatgtctaattgatattgcttctgtacatttctcacttttttggtccatttatacattactgggctgctaacttttatttttcaaaccagattttactatttgttgttgcaaacgaatcgtcgaaatttctgcccatctttaaggaagcatcaaaatcattcaaggggaaggtagtttttttttcttttgatccgtcaagttatcagcaaacttacttccgttgcttcacatgctttactcaaatttggtgctatgcaacaccacttatcactttcccattctatttatttactgatgtgttcgtttaccactgatgaggtgtgtggccaaaatgcagcttttgtttgtctttgtggagcgtgacaatgaggaagtaggtgaaccagttgccaactactttggtattactggacaagagaccacagtaatgacttgtgttctttgttacctttatctgtactgttgtttcttgcatcgaaattggatgctgcaatttagcctccatttaatgtgtttgtgttatttttttgtttgtccctatgactgtaggttcttgcttacactgggaatgaagatgctaggaattttttccttgatggtgaaatatcggtagagaatattaaggtaattgttgacacaggcccatgcacagtgccttattagatgtaaaaatagcataggagtgtgctcaagtagttcgaacaaattgttcattatgttaccaagtttcaagctagcatgtaatcaccaatcatttgagtttttttggcaaatgcattttctatttgtactgtattaatttaacctgagaatcttgcatgtatttgtggtttgtgcattatcaattaatattgcattttgtagtgaacaaatgcaatgtgcatctttttgcaatttatgcaccatgccgtttggtgtagaagttgtccttttaactagggtacttattacttttcttggacactgttgatattgagttctgccactgctagtgaggaaggagtcgactatcattctccaagaatttttcttattccttgaaggcttggttattggacacctttattgtttttatcctttttacatgcagagatttgctgaggatttcttagaggaaaagctcacaccgttctacaagtctgaacctgtacctgaatctgtgagtctataattatatgatgggttctttctccacttattgtaccataatgagacattctgtgttcccatacagaatgaaggagatgtcaaaattgttgttggaaaaaacctagatcagattgttttggatgaatcaaaagatgcccttttggaggtatgttcttcctggaaggtaaattatgagaaaaatggtatttatatgtggtccataatcgttgttgctgttgttgcagatatatgcaccatggtgtgggcattgtcaggaactggagcctacctacaacaagctaggaaagcatctccgtggcattgactcccttgtaatagctaaaatggatggcactgccaatgagcatccacgtgcaaaggtctgttctgcttcctgttggttttggcagtttcacttcacttttctttgaactggatattagaaagtaaaatttggaggcacgaaatgaagagtttaatttcctgtgctattgtggccaaaagatcttgtgcatgtatgatatgaaacaccgctagttatgaaaaatgtgagggttgctcaactgctttgttattcgaaatcgcacttttgcacactgcacaaaaaaggtacatatccatccatcatctaatactacatacatttcaatgttgatttacttctcatccatgtatatgtattcacgcactacgatctcacgagtatgcatcagtggtacagtattttgaggcagtagtgaccactgtagcatgtgaaatttgacttgtagttggaacaattcatttcccctccaatctccatgcaatctgaaccttcaagattggctcatagtttgctagtactattcttttatgtgattatcttccttaaattttcaatgcatgcatgcatgcatgcttagtcttgtttatttttccattttattatgttgtaaactttccatattacagaattaacacttgcttcttgtcacagcctgatggattcccaacgatcctcttttatccagcaggaaagaaaagttttgagcctgtaagtgcccaaatatgtgtcatgtcttattgaggggtgcatttgttactgtatgtaatctgtctctcagtaggtttgttacctctctcttcggtagaattgcctagatttcttataatctgctaaaaccgaaatatatctgtctctctctctctgtagaaatcttgaatcacctctctactatatgttaccgcactattcaaactgcatgcgtgtccttggtttcttgctaaaaaaaaatccaacctgcacggctgcacctatggcattgaagtcattctgcgctataacatttgttgaggtctttcccttaaaacaacatttgttgaggtcggaattcaagatacgttaggcgtatatctgacaagttatgtttatgagattttgagatcctgaaagggtccgtatataacagtatttaccagaagtctaatttagggagtgtttagatctaggggtgtaaagttttggcgtgtcacatcgggtatatagggtgtcgcatagggtgtttgcgcactaataaaaaaactaattacagaatccgtcagtaaaccacgagatgaatttattaagcctaattaatctatcattagtaaatgtttactgtagcaccacattgtcaaatcatggggcaattaggcttaaaaatccatctcgcaaattagtcacaatctatgcaattagttatttttttagtctatatttaatattttatgtagttgttcaaacgttcgatgtgatagggtgtaaaatttttgtgtgggaaccaaacagggccttatttaatttggctgtgcgttattgtgtgcagattacttttgagggggaccgtacggtggtggagatgtacaagtttatcaagaagcacgctagcatccctttcaaactgaagcggccggattcgtcagcaacgaaaacagagaaggatcagagcacagcttcaactaatttgaggggggagaggagttccggtacaaatttcaaggatgagttgtagtcttgtagagcggcattggtgcaacctttgaacaaggcaacgacgctctctagaaaaggctgtttctttttatgtatgcgagggcctgaggggcagcagaaaggaatccaaagttggtttctactttctatagagagtattccggtaaggagttagcttggacgatgtgcatgttgagatgaacgaattgaatcgaatcgaatggaataaaagcaaacgaaacggcttcg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0100100, RefSeq:Os02g0100100