Difference between revisions of "Os02g0114000"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os02g0114000| Description = Bromodomain containing protein| Version = NM_001052200.2 GI:297598474 GeneID:4328058| Length = 2692 bp| Definition ...")
 
 
(13 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
Please input one-sentence summary here.
GeneName = Os02g0114000|
 
Description = Bromodomain containing protein|
 
Version = NM_001052200.2 GI:297598474 GeneID:4328058|
 
Length = 2692 bp|
 
Definition = Oryza sativa Japonica Group Os02g0114000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Function===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
Os02g0114000 is one of SNF2 family genes.The catalytic subunits of chromatin remodeling complexes belong to the SNF2 family of DNA-dependent ATPases.Their catalytic core consists of two characteristic domains, the SNF2_N domain located at the N-terminus and the Helic C domain located at the C-terminus. Now there are five classes of ATP-dependent chromatin remodelers operating in eukaryotes: SWI/SNF, ISWI, CHD1, SWR1 and RAD54.The first SWI/SNF ATPase was found in ''Saccharomyces cerevisiaemutants'' which showed sucrose-nonfermenting and mating type switching defective phenotypes, thus the SNF2 family has got its name. The studies in single-cell organisms, invertebrates and mammals have indicated that SWI/SNF ATPases are essential for transcriptional reprogramming, morphogenesis, early embryo develop-ment, patterning and differentiation throughout development. In plants, detailed research on two viable null mutants of SWI/SNF ATPases,SPLAYED (SYD) and BRAHMA (BRM), in ''Arabidopsis thaliana'', improved our information on critical roles of plant SWI/SNF ATPases. Both SYD and BRM regulate stem cell maintenance, patterning (alteration of leaf polarity, flower morphogenesis and ovule development), develop-mental transitions (precocious onset of reproductive development) and growth (small stature, slow growth and reduced apical dominance), while BRM also controls root growth and male fertility. Recently SYD has been found to be also required for selective pathogen resistance and regulation of the specific pathways within biotic stress signaling networks. ATCHR12, another SWI/SNF ATPase in A. thaliana, has been demonstrated to play a vital role in mediating the temporary growth arrest of Arabidopsisupon perception of environmental stresses. All these three SWI/SNF ATPases have an HSA domain at the N-terminus, lately shown to mediate critical interactions required for SWI/SNF-dependent trans-criptional activation. BRM also have a C-terminal BROMO domain found to target remodeling complexes to hyperacetylated chromatin in yeast.
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Expression===
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
+
Following picture shows that rice SNF2 protein domain architectures, sequence similarity tree and expression patterns for rice SNF2genes from
AP = Chromosome 2:748726..751417|
+
microarray or RT-PCR.
CDS = 749122..749799,750123..750371,751380..751415|
+
[[File:tree11.jpg]]
GCID = <gbrowseImage1>
+
 
name=NC_008395:748726..751417
+
Tissue-specific expression patterns of the eight SNF2genes detected by RT-PCR. The rice Actingene (OsAct1) was used as an
source=RiceChromosome02
+
internal control.
preset=GeneLocation
+
[[File:pcr1.jpg]]
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
Expression profiles of the eight SNF2genes detected by RT-PCR under phytohormonetreatments and abiotic stresses
name=NC_008395:748726..751417
+
[[File:pcr2.jpg]]
source=RiceChromosome02
+
 
preset=GeneLocation
+
Os02g0114000was more abundant in floral primordial, young panicles, leaves and roots than in stems and mature
</gbrowseImage2>|
+
mature panicles and anthers.
CDNA = <cdnaseq>agtggaacaaagatgtctgacagtatgcaaagaaagtgcaagaacgtgataaacaagctttggaggaggattgacaaagagggtcatcaaatcataccaaatatatcttcttggtggcgtaggaacgagaattcctcattcaaaggtttggctagcagcacccttgatctacagaaaattgaacaacgagttgatggatttgagtatggcggtgtgaatgaattcatagctgacatgcagcagatgctgaaaagtgtggttcaacatttcagctataggcatgaggtccgagtagaagctgagaccctccacaacttatttttcaatataatgaagattgcctttccggactcagacttcagagaagctaagggtgctatgtcattttcgaatcctggaggaggtgcaagtggctctgctgcgcaatcaacaaagcaatctgcttcaggccagaaacgtcgttcaagcaccagtgaagcggagcagcatggttcaagcactagcagacacaatcagcatgcaccagttggtgaggtttcaggccgggcccacacttcaaaatctgagaaggactcccggcattctggaccaggtagcagggaacagttcacggatagcgcagggctgttcaggcaccctacagatatgttcatagttaagaagaagagagatcgaaggccgagcctggggtctccatccagttcaggccgaactggaccgctctccccgaccaacgccgggcggatgggaccggcgccatcacctagaggtgccaggacgcccttccaaagagatccacacccttctcagcagtctatgcattcagctggatggggtgctcattctgtgcagcaatctgatcgtggggggagttcatcacccggcattggagacatccagtgggctaaacctaccaagagatcgaggactgatagtggcaaaagacggccaagccatatgtga</cdnaseq>|
+
 
AA = <aaseq>SGTKMSDSMQRKCKNVINKLWRRIDKEGHQIIPNISSWWRRNEN                    SSFKGLASSTLDLQKIEQRVDGFEYGGVNEFIADMQQMLKSVVQHFSYRHEVRVEAET                    LHNLFFNIMKIAFPDSDFREAKGAMSFSNPGGGASGSAAQSTKQSASGQKRRSSTSEA                    EQHGSSTSRHNQHAPVGEVSGRAHTSKSEKDSRHSGPGSREQFTDSAGLFRHPTDMFI                    VKKKRDRRPSLGSPSSSGRTGPLSPTNAGRMGPAPSPRGARTPFQRDPHPSQQSMHSA                    GWGAHSVQQSDRGGSSSPGIGDIQWAKPTKRSRTDSGKRRPSHM</aaseq>|
+
The probable cross-talk draft in which the eight genes were involved.
DNA = <dnaseqindica>1619..2296#1047..1295#3..38#caagtggaacaaagatgtctgacagtatgcaaagaaaggtagcatacaaaacctagttctttgtatgtttcagctggtttactctgttagagctactcattgcctcgtcttttaaaacttaaaaggatattggatattgaacttcggcaaggaatactttgtagaatttagtatactctgtcgtgtaagcatcatcttaagaaagatggttccgccttcaaaatagcagagccatgatccttccaaatgtaggaatagaccattttagtatgcaatagacaaacgctagctaaaaactgccaccacacatggcttggtccctgctcgttaaacgttgccgagcatggaaaactagaacagatgagcaatatatcaaggaagcaatgttctttttaccttggaaacataaatggatctgcagttttctatagaagtataatacttgcctaaaatcttgtaaaatatttattcggactgttaactcaacttgataacataaatatggaagttaaatgttgcctacataccgggatagttgaggtctaccaaatatactgcattgctaggtaaatctcgactgctatctgcttgcattagcaaaagagccaagtatgacgccgcttatttcatgtggtgttttcacattgttctacaatcataacaacgtaagtcccgtgcagtggttgtggggtgcacgtgaagtggtgtggactatttcatgactattgcctgtttttgcttatactgattactagtgtagtttttggatatcatttattactacagcttatccgttgtgttgattttgttgtagattccttttgccatttggtttggctcatattgtttgccttcttttttttttgactgcttttgcttacactgattactagtgtagtttttggatatcatttattactacagcttatcttaatgttgaggttgtctcaattttgttgtaattcctttcgcaaatggtttggctcgtattgtttgcctttttaacagctctttatagctaagcgtttctcattcaatacctgcagtgcaagaacgtgataaacaagctttggaggaggattgacaaagagggtcatcaaatcataccaaatatatcttcttggtggcgtaggaacgagaattcctcattcaaaggtttggctagcagcacccttgatctacagaaaattgaacaacgagttgatggatttgagtatggcggtgtgaatgaattcatagctgacatgcagcagatgctgaaaagtgtggttcaacatttcagctataggcatgaggtaatttcatagtactagaaaagcttccttttttgtccttaatttgtataaattgaagtatcatgggggtcattccaatgctgacaccatgggtccatggtcgccatcaagtttgttgacattctctctctacttggtactgattactatttaaaattcagaagaactgcgtagctttctgtattcctgaagaaaaccatgttgacttaatagaataagataccacgacatacttgcacagactctaattctgtgaattcatacttctctaacttctgatagtctgactggtgtactcgtgaatttgctcctacaaaatgcaggtccgagtagaagctgagaccctccacaacttatttttcaatataatgaagattgcctttccggactcagacttcagagaagctaagggtgctatgtcattttcgaatcctggaggaggtgcaagtggctctgctgcgcaatcaacaaagcaatctgcttcaggccagaaacgtcgttcaagcaccagtgaagcggagcagcatggttcaagcactagcagacacaatcagcatgcaccagttggtgaggtttcaggccgggcccacacttcaaaatctgagaaggactcccggcattctggaccaggtagcagggaacagttcacggatagcgcagggctgttcaggcaccctacagatatgttcatagttaagaagaagagagatcgaaggccgagcctggggtctccatccagttcaggccgaactggaccgctctccccgaccaacgccgggcggatgggaccggcgccatcacctagaggtgccaggacgcccttccaaagagatccacacccttctcagcagtctatgcattcagctggatggggtgctcattctgtgcagcaatctgatcgtggggggagttcatcacccggcattggagacatccagtgggctaaacctaccaagagatcgaggactgatagtggcaaaagacggccaagccatatgtgaaaaagaaaagagggattgttattcttggcattgcggtgtacattccttagcacccttgaatcttgattgacctctctacccgctgctgattctggagcccattggcctggttttgacacccatttcttcgtcgccattcctgccatccttcaaagaagttatcacgaccgtctgggactgacttgtgttgtcatggacattgtgggaaatgtgggtaggagtaatcgttcttgtatgttggtattttctgtaaagggcaaacacatttaatcttgttctctgttgactgttaagtagcgctccatccaactggagatgtgatggcgatctcatgtcatgatgatgtagtttagtagccatggaatgaaatgaaatgaagctgagccggttataata</dnaseqindica>|
+
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052200.2 RefSeq:Os02g0114000]|
+
[[File:Different issue effect Os04g0629300 and other rice SNF2 grnes.jpg]]
}}
+
 
[[Category:Genes]]
+
Os02g0114000 showed no response to any exogenous phytohormone treatment. Os02g0114000was the only gene whose transcript abundance appeared not significantly changed under any stress. Os02g0114000 exhibited no responses to both phytohormones and abiotic stresses. It is infered that this gene may be requisite for maintaining basic physiological activities.
[[Category:Japonica mRNA]]
+
 
[[Category:Oryza Sativa Japonica Group]]
+
===Evolution===
[[Category:Japonica Genes]]
+
Please input evolution information here.
[[Category:Japonica Chromosome 2]]
+
 
[[Category:Chromosome 2]]
+
You can also add sub-section(s) at will.
 +
 
 +
==Labs working on this gene==
 +
State Key Laboratory for Conservation and Utilization of Subtropical Agro-Bioresources, College of Life Sciences, South China Agricultural University, Wushan, Guangzhou 510642, P.R. China
 +
 
 +
==References==
 +
Li X Y, Wang C, Nie P P, et al. Characterization and expression analysis of the SNF2 family genes in response to phytohormones and abiotic stresses in rice[J]. Biologia Plantarum, 2011, 55(4): 625-633.
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

Latest revision as of 06:24, 14 May 2015

Please input one-sentence summary here.

Annotated Information

Function

Os02g0114000 is one of SNF2 family genes.The catalytic subunits of chromatin remodeling complexes belong to the SNF2 family of DNA-dependent ATPases.Their catalytic core consists of two characteristic domains, the SNF2_N domain located at the N-terminus and the Helic C domain located at the C-terminus. Now there are five classes of ATP-dependent chromatin remodelers operating in eukaryotes: SWI/SNF, ISWI, CHD1, SWR1 and RAD54.The first SWI/SNF ATPase was found in Saccharomyces cerevisiaemutants which showed sucrose-nonfermenting and mating type switching defective phenotypes, thus the SNF2 family has got its name. The studies in single-cell organisms, invertebrates and mammals have indicated that SWI/SNF ATPases are essential for transcriptional reprogramming, morphogenesis, early embryo develop-ment, patterning and differentiation throughout development. In plants, detailed research on two viable null mutants of SWI/SNF ATPases,SPLAYED (SYD) and BRAHMA (BRM), in Arabidopsis thaliana, improved our information on critical roles of plant SWI/SNF ATPases. Both SYD and BRM regulate stem cell maintenance, patterning (alteration of leaf polarity, flower morphogenesis and ovule development), develop-mental transitions (precocious onset of reproductive development) and growth (small stature, slow growth and reduced apical dominance), while BRM also controls root growth and male fertility. Recently SYD has been found to be also required for selective pathogen resistance and regulation of the specific pathways within biotic stress signaling networks. ATCHR12, another SWI/SNF ATPase in A. thaliana, has been demonstrated to play a vital role in mediating the temporary growth arrest of Arabidopsisupon perception of environmental stresses. All these three SWI/SNF ATPases have an HSA domain at the N-terminus, lately shown to mediate critical interactions required for SWI/SNF-dependent trans-criptional activation. BRM also have a C-terminal BROMO domain found to target remodeling complexes to hyperacetylated chromatin in yeast.

Expression

Following picture shows that rice SNF2 protein domain architectures, sequence similarity tree and expression patterns for rice SNF2genes from microarray or RT-PCR. Tree11.jpg

Tissue-specific expression patterns of the eight SNF2genes detected by RT-PCR. The rice Actingene (OsAct1) was used as an internal control. Pcr1.jpg

Expression profiles of the eight SNF2genes detected by RT-PCR under phytohormonetreatments and abiotic stresses Pcr2.jpg

Os02g0114000was more abundant in floral primordial, young panicles, leaves and roots than in stems and mature mature panicles and anthers.

The probable cross-talk draft in which the eight genes were involved.

Different issue effect Os04g0629300 and other rice SNF2 grnes.jpg

Os02g0114000 showed no response to any exogenous phytohormone treatment. Os02g0114000was the only gene whose transcript abundance appeared not significantly changed under any stress. Os02g0114000 exhibited no responses to both phytohormones and abiotic stresses. It is infered that this gene may be requisite for maintaining basic physiological activities.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

State Key Laboratory for Conservation and Utilization of Subtropical Agro-Bioresources, College of Life Sciences, South China Agricultural University, Wushan, Guangzhou 510642, P.R. China

References

Li X Y, Wang C, Nie P P, et al. Characterization and expression analysis of the SNF2 family genes in response to phytohormones and abiotic stresses in rice[J]. Biologia Plantarum, 2011, 55(4): 625-633.

Structured Information