Difference between revisions of "Os02g0148100"

From RiceWiki
Jump to: navigation, search
 
(4 intermediate revisions by one other user not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Under dehydration conditions, the suppressed lines showed lower osmotic potential compared with that of wild-type plants, suggesting a role ofOsMAPK33 in osmotic homeostasis. Nonetheless, the suppressed lines did not display any significant difference in drought tolerance compared with their wild-type plants. With increased salinity, there was still no difference in salt tolerance between OsMAPK33-suppressed lines and their wild-type plants. However, the overexpressing lines showed greater reduction in biomass accumulation and higher sodium uptake into cells, resulting in a lower K+/Na+ ratio inside the cell than that in the wild-type plants andOsMAPK33-suppressed lines. These results suggest that OsMAPK33could play a negative role in salt tolerance through unfavourable ion homeostasis. Gene expression profiling ofOsMAPK33transgenic lines through rice DNA chip analysis showed that OsMAPK33altered expression of genes involved in ion transport.<ref name="ref1" />
+
Under dehydration conditions, the suppressed lines showed lower osmotic potential compared with that of wild-type plants, suggesting a role of OsMAPK33 in osmotic homeostasis. Nonetheless, the suppressed lines did not display any significant difference in drought tolerance compared with their wild-type plants.  
 +
 
 +
With increased salinity, there was still no difference in salt tolerance between OsMAPK33-suppressed lines and their wild-type plants. However, the overexpressing lines showed greater reduction in biomass accumulation and higher sodium uptake into cells, resulting in a lower K+/Na+ ratio inside the cell than that in the wild-type plants and OsMAPK33-suppressed lines. These results suggest that OsMAPK33 could play a negative role in salt tolerance through unfavourable ion homeostasis. Gene expression profiling of OsMAPK33 transgenic lines through rice DNA chip analysis showed that OsMAPK33 altered expression of genes involved in ion transport.<ref name="ref1" />
  
 
===Expression===
 
===Expression===
Line 10: Line 12:
 
===Evolution===
 
===Evolution===
 
OsMAPK33 showed approximately 47–93% identity at the amino acid level with other plant MAPKs.<ref name="ref1" />
 
OsMAPK33 showed approximately 47–93% identity at the amino acid level with other plant MAPKs.<ref name="ref1" />
 +
 +
Sequence
 +
analysis revealed that the cDNA, renamed as OsMAPK33 (Os02g0148100), had a high degree of similarity to the Ser/Thr protein kinase genes (MAPKs) of other plant species. OsMAPK33 contained 11 conserved subdomains and the phosphorylation activation motif (TEY) found in Ser/Thr protein kinases. OsMAPK33 was found to be the most closely related to OsMAP2 (92.7%) as previously reported <ref name="ref2" />. It also showed 44.1–92.7% identity at the amino acid level with previously reported plant MAPKs. The OsMAPK33 cDNA was 1549 bp long and encoded a polypeptide of 370 amino acids with a predicted molecular mass of 42.5 kDa. This cDNA had the same deduced amino acid sequence as OsMAP3 (AF216317) <ref name="ref2" /> and OsMAPK2 (AF241166). The OsMAPK33 cDNA was recently annotated as‘OsMPK14’by The Institute for Genomic Research (TIGR) rice MAPK community. Phylogenetic analysis indicated that OsMAPK33
 +
belongs to C group (C2) of MAPK proteins, along with OsMAPK4, Osmsrmk3 and OsMAP2.
 +
[[File:OsMAPK33 Phylogenetic.png]]
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 24: Line 31:
 
<ref name="ref1">
 
<ref name="ref1">
 
Lee S-K, Kim B-G, Kwon T-R, Jeong M-J, Park S-R, Lee J-W, Byun M-O, Kwon H-B, Matthews BF, Hong C-B and Park S-C 2011 Overexpression of the mitogen-activated protein kinase geneOsMAPK33enhances sensitivity to salt stress in rice (Oryza sativaL.).J. Biosci.36 139–151
 
Lee S-K, Kim B-G, Kwon T-R, Jeong M-J, Park S-R, Lee J-W, Byun M-O, Kwon H-B, Matthews BF, Hong C-B and Park S-C 2011 Overexpression of the mitogen-activated protein kinase geneOsMAPK33enhances sensitivity to salt stress in rice (Oryza sativaL.).J. Biosci.36 139–151
 +
</ref>
 +
<ref name="ref2">
 +
Wen JQ, Oono K and Imai R 2002 Two novel mitogen-activated protein signaling components, OsMEK1 and OsMAP1, are involved in a moderate low-temperature signaling pathway in rice. Plant Physiol.1291880–1891
 
</ref>
 
</ref>
 
</references>
 
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0148100|
 
Description = MAP kinase MAPK2 (MAP kinase 3)|
 
Version = NM_001052424.1 GI:115444218 GeneID:4328297|
 
Length = 3305 bp|
 
Definition = Oryza sativa Japonica Group Os02g0148100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:2643054..2646358|
 
CDS = 2643310..2643999,2645043..2645465|
 
GCID = <gbrowseImage1>
 
name=NC_008395:2643054..2646358
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:2643054..2646358
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgatcatggtggatcctccaaatgggatgggtaaccaagggaagtattactactcgatgtggcaaactttgtttgagatagacactaagtatgtgccaatcaagcccatcgggcgaggagcttatgggattgtttgttcatccataaatcgtgagaccaacgagaaagtagcaataaagaagatacacaatgtttttgacaaccgtgttgatgcactaaggactttgcgggagctgaaacttctccggcatctccgccatgagaatgttattgctttgaaggatataatgatgccagtacacaggaggagttttaaagatgtgtacttagtttatgaactcatggatactgacctgcatcagataatcaagtcacctcagggtctttccaatgatcactgccaatattttctttttcagttgcttcgaggactgaaatatctccattcagcagagatactccacagagacctgaaacctggaaatctactggttaatgcaaactgtgatctcaagatatgtgattttggtcttgcacgcacaaacagtagtaaaggtcagtttatgactgagtatgttgtcacccgctggtatagagctcctgagttgctcctttgctgtgacaactatggcacttccattgatgtttggtctgttggttgcatcttcgctgagctacttggtcggaaacctattttcccaggaactgagtgcctaaatcagctcaagctcattgtcaatgttcttggcaccatgagcgagtctgacttggagttcattgacaacccaaaagctcgcagatatatcaaatccctcccctacactcccggtgtgcccctcgcgagtatgtatccgcatgcacaccctcttgccattgatcttttacagaagatgctcatatttgatcctaccaaaagaatcagtgtcaccgaggctcttgagcacccttacatgtcccctctgtatgatccaagtgcaaatcctcccgcgcaagtgcctatcgatctggacatagacgagaacatcagtgcagatatgatcagggaaatgatgtggcacgagatgctccactaccaccctgaagttgttgcagcaatgagtgcccgatga</cdnaseq>|
 
AA = <aaseq>MAIMVDPPNGMGNQGKYYYSMWQTLFEIDTKYVPIKPIGRGAYG                    IVCSSINRETNEKVAIKKIHNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPVH                    RRSFKDVYLVYELMDTDLHQIIKSPQGLSNDHCQYFLFQLLRGLKYLHSAEILHRDLK                    PGNLLVNANCDLKICDFGLARTNSSKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVW                    SVGCIFAELLGRKPIFPGTECLNQLKLIVNVLGTMSESDLEFIDNPKARRYIKSLPYT                    PGVPLASMYPHAHPLAIDLLQKMLIFDPTKRISVTEALEHPYMSPLYDPSANPPAQVP                    IDLDIDENISADMIREMMWHEMLHYHPEVVAAMSAR</aaseq>|
 
DNA = <dnaseqindica>2360..3049#894..1316#atccacacctcacgggaagctgtcccttctcctcttctcctcctcggctgcggccacggcgacgacgacgacgacgaattcgagcgaggcgatcggcgatggaggcggtggcgatctgatccgctcttcccgtctcggcctcgcgctcctctccctccctcgcggtgtctcggggtgaggggaatcttttgtttttgttttttttgaccgtactgttctggctgggtgtttcttggtcgtggtccaagatcggcgggtggtttgtttgtccgggctccatggatcgatctctctctgttgatctgtgtagctggagaagctcagctccgtgggaggattacgcgcgcgtgattggttgggctgtgtgtaaatttggttgccggccatttttgtgctccggtggtgaatttgggtggtgaggctgtctgcacaatccgtggcgatgagctgggaaatgtgatgggggtgtgctcgtatcgggatgatggtgggttgtttggttgacccggatgagtgatgatgattcacaatcttgcatccatgaaccgtgggatgggtgtccatgtctttctccgggattgggaattggtaccaccaccatggcggttctaaaggcgggaggagataaatgcaggcggcaatgcatgcttggtgatggagcatctgtatgagtgtgcggggatcgatgctccatgttcattcagaaccatagccgagcaactgaaagctcatcttgaagactgggactgcgtttaatttatagctcatctttgattacaaagttgtttgatcttctgcattcatagatagtttggcagttgtgtaagctcaaaaagccgttgttatttcctaaggtagtactaacttattttcttttgtttccttagtaggaaatggcgatcatggtggatcctccaaatgggatgggtaaccaagggaagtattactactcgatgtggcaaactttgtttgagatagacactaagtatgtgccaatcaagcccatcgggcgaggagcttatgggattgtttgttcatccataaatcgtgagaccaacgagaaagtagcaataaagaagatacacaatgtttttgacaaccgtgttgatgcactaaggactttgcgggagctgaaacttctccggcatctccgccatgagaatgttattgctttgaaggatataatgatgccagtacacaggaggagttttaaagatgtgtacttagtttatgaactcatggatactgacctgcatcagataatcaagtcacctcagggtctttccaatgatcactgccaatattttctttttcaggtaatacctggacctctcttttctattctattctacatttacttactcaagagtaattgtgtgtttttaatggcccttgatgattgcttagaatttgtgacagtgcatcttatatcggcaagcctcatccagtcttataagatggttcattcccaaatgcacgaggcacaatcttaacttgaatggttcttctgtcagttaaaacttcaaagtcaaactgattttttaaacatgtaaaattgtgaatgttttgcttcagcaatgatttgtgagcatgtcaatgacaatacttttttgagtaatgtattcctaatttgaaataaccaatgtaacttgtagtatcattcagtttgattccagttgatttgatgtttttgcattagtagtatttgaaaaaaactgaaaaaatggcctactatatttattccaacccagattccaacagtttagactgataataaatagatggaaggcaaaactatatccctgtagtctgcagctttgagacaaactaaactacacactttgtgcattaagtattgccatcatgattcctctttttatacattttattttaatttgtagagttgaacatttattttcatgtgtcacaggcacaacatccatgcattcccttgttgcctcatcaagtacataaaaaagcagctattctaatgtccgttcaacctaaaactggaactggaaccatctagccctttttagatttccatctattctaacttattttattaatttcgttaaaccacatttccattaagaatttcatatacagttcataatctaaaacctagatcttctttcaaatagttctgcatagaggcttctgcatgaaaccacacaagtagaccctcttgtttacaagacataaatatttttctgatgaattgtctgttcatcctacccttcagattcatttattctgttgtcttgagttcattttggattgtctaccatgtatttcttattttttgcaatccgtattttccagatgatttaagagaatgttgttttcttgattgtagttgcttcgaggactgaaatatctccattcagcagagatactccacagagacctgaaacctggaaatctactggttaatgcaaactgtgatctcaagatatgtgattttggtcttgcacgcacaaacagtagtaaaggtcagtttatgactgagtatgttgtcacccgctggtatagagctcctgagttgctcctttgctgtgacaactatggcacttccattgatgtttggtctgttggttgcatcttcgctgagctacttggtcggaaacctattttcccaggaactgagtgcctaaatcagctcaagctcattgtcaatgttcttggcaccatgagcgagtctgacttggagttcattgacaacccaaaagctcgcagatatatcaaatccctcccctacactcccggtgtgcccctcgcgagtatgtatccgcatgcacaccctcttgccattgatcttttacagaagatgctcatatttgatcctaccaaaagaatcagtgtcaccgaggctcttgagcacccttacatgtcccctctgtatgatccaagtgcaaatcctcccgcgcaagtgcctatcgatctggacatagacgagaacatcagtgcagatatgatcagggaaatgatgtggcacgagatgctccactaccaccctgaagttgttgcagcaatgagtgcccgatgatcttcaactgtccccaggaactttgcaggctcacttttttttcttcttctaaaagcctacggcgattatcgcacctattaagtaaccaagacgtgcaagacttatttcatgtatatatgagcgaaataagaacgttgttgtatccatatagttcatgttatggaccattacttggtgtatgcatttcacatttccactggacagttatgttgttgtactagttcatgatgagaagtgctattaaagtgaattcagt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052424.1 RefSeq:Os02g0148100]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 06:26, 14 May 2015

OsMAPK33 (Os02g0148100) is a Mitogen-activated protein kinases (MAPK) cDNA clone in rice, which is mainly induced by drought stress

Annotated Information

Function

Under dehydration conditions, the suppressed lines showed lower osmotic potential compared with that of wild-type plants, suggesting a role of OsMAPK33 in osmotic homeostasis. Nonetheless, the suppressed lines did not display any significant difference in drought tolerance compared with their wild-type plants.

With increased salinity, there was still no difference in salt tolerance between OsMAPK33-suppressed lines and their wild-type plants. However, the overexpressing lines showed greater reduction in biomass accumulation and higher sodium uptake into cells, resulting in a lower K+/Na+ ratio inside the cell than that in the wild-type plants and OsMAPK33-suppressed lines. These results suggest that OsMAPK33 could play a negative role in salt tolerance through unfavourable ion homeostasis. Gene expression profiling of OsMAPK33 transgenic lines through rice DNA chip analysis showed that OsMAPK33 altered expression of genes involved in ion transport.[1]

Expression

OsMAPK33 is found to exhibit organ-specific expression with relatively higher expression in leaves as compared with roots or stems, and to exist as a single copy in the rice genome.[1]

Evolution

OsMAPK33 showed approximately 47–93% identity at the amino acid level with other plant MAPKs.[1]

Sequence analysis revealed that the cDNA, renamed as OsMAPK33 (Os02g0148100), had a high degree of similarity to the Ser/Thr protein kinase genes (MAPKs) of other plant species. OsMAPK33 contained 11 conserved subdomains and the phosphorylation activation motif (TEY) found in Ser/Thr protein kinases. OsMAPK33 was found to be the most closely related to OsMAP2 (92.7%) as previously reported [2]. It also showed 44.1–92.7% identity at the amino acid level with previously reported plant MAPKs. The OsMAPK33 cDNA was 1549 bp long and encoded a polypeptide of 370 amino acids with a predicted molecular mass of 42.5 kDa. This cDNA had the same deduced amino acid sequence as OsMAP3 (AF216317) [2] and OsMAPK2 (AF241166). The OsMAPK33 cDNA was recently annotated as‘OsMPK14’by The Institute for Genomic Research (TIGR) rice MAPK community. Phylogenetic analysis indicated that OsMAPK33 belongs to C group (C2) of MAPK proteins, along with OsMAPK4, Osmsrmk3 and OsMAP2. OsMAPK33 Phylogenetic.png

Labs working on this gene

1. Department of Agricultural Biotechnology, National Academy of Agricultural Science, Rural Development Administration, Suwon 441–857, Republic of Korea

2. Department of Biomedical Science, Sun Moon University, Asan 336–708, Republic of Korea

3. Soybean Genomics and Improvement Lab, USDA-ARS, Beltsville, MD 20705, USA

4. Department of Biological Sciences, Seoul National University, Seoul 151–742, Republic of Korea

References

  1. 1.0 1.1 1.2 Lee S-K, Kim B-G, Kwon T-R, Jeong M-J, Park S-R, Lee J-W, Byun M-O, Kwon H-B, Matthews BF, Hong C-B and Park S-C 2011 Overexpression of the mitogen-activated protein kinase geneOsMAPK33enhances sensitivity to salt stress in rice (Oryza sativaL.).J. Biosci.36 139–151
  2. 2.0 2.1 Wen JQ, Oono K and Imai R 2002 Two novel mitogen-activated protein signaling components, OsMEK1 and OsMAP1, are involved in a moderate low-temperature signaling pathway in rice. Plant Physiol.1291880–1891

Structured Information