|
|
| (6 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | {{JaponicaGene|
| + | Please input one-sentence summary here. |
| − | GeneName = Os02g0516400|
| |
| − | Description = WW/Rsp5/WWP domain containing protein|
| |
| − | Version = NM_001053492.2 GI:297599303 GeneID:4329477|
| |
| − | Length = 2393 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0516400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| + | ==Annotated Information== |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| + | ===Function=== |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| + | CFL1 encodes a WW domain protein, and there are two homologs of rice CFL1in Arabidopsis:At CFL1 and At CFL2. Arabidopsisplants overexpressing AtCFL1displayed |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| + | organ fusion phenotypes with decreased levels of epicuticular wax and defective cuticles. Loss-of- CFL1-function resulted in an enhancement of cuticle properties in Arabidopsis. Biochemical evidence showed that At CFL1 interacts with HDG1, a class IV homeodomain-leucine zipper transcription factor. Suppression of HDG1 function resulted in similar defective cuticle phenotypes in wild-type Arabidopsis but much alleviated phenotypes in Atcfl1-1 mutants. The expression of two cuticle development-associated genes,BDGand FDH, was downregulated in At CFL1 overexpress or and HDG1 suppression plants. HDG1 binds to the cis-element L1 box, which exists in the regulatory regions of BDGand FDH. rice and Arabidopsis CFL1 negatively regulate cuticle development by affecting the function of HDG1, which regulates the downstream genes BDGand FDH. |
| − | |
| + | |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| + | ===Expression=== |
| − | AP = Chromosome 2:19418357..19420749|
| + | At CFL1 was predominantly expressed in specialized epidermal cells and in regions where dehiscence and abscission occur. |
| − | CDS = 19418357..19418980,19420549..19420749|
| + | |
| − | GCID = <gbrowseImage1>
| + | ===Evolution=== |
| − | name=NC_008395:19418357..19420749
| + | Please input evolution information here. |
| − | source=RiceChromosome02
| + | |
| − | preset=GeneLocation
| + | You can also add sub-section(s) at will. |
| − | </gbrowseImage1>|
| + | |
| − | GSID = <gbrowseImage2>
| + | ==Labs working on this gene== |
| − | name=NC_008395:19418357..19420749
| + | State Key Laboratory for Protein and Plant Gene Research, College of Life Sciences, Peking University |
| − | source=RiceChromosome02
| + | Institut fur Zellulare and Molekulare Botanik, Universitat Bonn |
| − | preset=GeneLocation
| + | The National Plant Gene Research Center (Beijing) |
| − | </gbrowseImage2>|
| + | |
| − | CDNA = <cdnaseq>atgactgccccgaacatcgagatgatcgcctcgtcgctgcgcaactgctccctcaacggcgggggaggaggaggaggagggcggcgcagggggaggcgcgcggcggcggcggaggggagcgacgacagcgagggggtcaccgtcgagctcaactccgaggtcgccctgccctaccactgggagcagtgcctcgacatccggacggggcaagtttactacatcaactgggaggacggcacccggacgaccatcgatccgcgctcgtcgtcggcgtactcgccgtcgccggcgtcgcggtccgcgtcgtcctcctcccgccgctgctcgcgcgcgcggggccgcggcggcggaggcggcgccgccgccgcggcgtcgaccaccacgtcgtcggggtacacctccgtgtcgtccgtgggcgcggtcaccgcggcggcggcggcgtggcgctcgcacgacagcagcgggcacggctacggctacggctacggctacggcagctatggctacggctacggctacgacggccgcgacggcgacgacgaggagagcagcagcagcagtagcagcagcagcagcagcagcagcagcgccagcagcagccggggctccgccgtgtcgtccacgctctcgtcgttctcccccaccgacgagtcggcctccggcgccggcagcggctacgccgtcggcgacaacggcgcccacgtcctcgtcgccgccggctgccgggcttgcttcatgtacttcatggtgccgaagaccgccgacgtgtgccccaagtgcggcagctccggcctcctccacctcagccgcaacggctacgtctga</cdnaseq>|
| + | ==References== |
| − | AA = <aaseq>MTAPNIEMIASSLRNCSLNGGGGGGGGRRRGRRAAAAEGSDDSE GVTVELNSEVALPYHWEQCLDIRTGQVYYINWEDGTRTTIDPRSSSAYSPSPASRSAS SSSRRCSRARGRGGGGGAAAAASTTTSSGYTSVSSVGAVTAAAAAWRSHDSSGHGYGY GYGYGSYGYGYGYDGRDGDDEESSSSSSSSSSSSSSASSSRGSAVSSTLSSFSPTDES ASGAGSGYAVGDNGAHVLVAAGCRACFMYFMVPKTADVCPKCGSSGLLHLSRNGYV</aaseq>|
| + | Renhong Wu, et al. CFL1, a WW Domain Protein, Regulates Cuticle Development by Modulating the Function of HDG1, a Class IV Homeodomain Transcription Factor, in Rice and Arabidopsis. The Plant Cell, 2011, 23(9): 3392-3411 |
| − | DNA = <dnaseqindica>1770..2393#1..201#atgactgccccgaacatcgagatgatcgcctcgtcgctgcgcaactgctccctcaacggcgggggaggaggaggaggagggcggcgcagggggaggcgcgcggcggcggcggaggggagcgacgacagcgagggggtcaccgtcgagctcaactccgaggtcgccctgccctaccactgggagcagtgcctcgacatccgggtacgtctactactactcgcccatctcttcttccacacatgcatccatacatgcatacgccgcgtttccttttcttccccgatcgattcttgcggcggcggcggcggtgggcggcggcgcgccgccctttgtccaatcatttggagacataaatggatagcagtttccgaggtaggtgggtgtggtttggtttgggctcgattgggatcaatcatttgatcattaatggcgaaagcgggcgctcgaactggagagagagacgagacgagacgacccgtccgcgctgattttttttttcttcttcctcctcttctctttctgctcctcgtctcccttctctcttcttgttcttgttcttggatccttgcttcatctgcgattcctctcttcgtctatgcaaatattttttttatttatctctgttttttttcttcggttcttatcttcgtttggttggggattcgatcatcttcagagagattcaggccgttctttttaacacagggatgacaaaagttcagaaaagaaacctcggaaaagatggtactatttttttctttttttttgttgatgatatcaaggctcttcaaatctccacaccttctctggtctctgatctaagcgcgcattcagatctgtgttgcattctaaatttctgacacatccctgtagatccattcctttttgctctgtctctatctgaaactctagatttcgctatagatttcttctggaccacaatgctctgtttttttggtcctgggttctaatctaatcgcagagctttgttaaacaccagatgattctcacctctgggaaatcttcagttccattgtgacaaagtgtctccctttctttttcatccctgctagtactttgaacagacgaatgaatgcctaccccaatgaagattcatgcgtattaatcaccaaaatggagtgttcatctccaccttgtctccagcaacagagtagacaaaaatgctcttcttatggttatttcagtagccttttctgaagatactactgcaatacatttatgtgctttttaagtagaacagctttcctgcagattagagtttttttttttttacaaaggatgaaatgagaatttggtggtggtgttcttcattgccaaccttgccctgtgatttgcaaacaaacaagaggacaaagagagcagcattcattacaccatttgatccagattttttttctttcccctgttctgctgtactttgttatgggcatcagttattaataggttctcaaccttgtttcacggaagcaactgaatgccaccgcattaattgttcttgcagactgtcaccaaaatgtacttgtagattttccccacccaaacttctccatgcatcatgcacatttactcaccacattcttgaaacagcatttcgccatttgcaagattaacttaatctgtaccactagctgtctagttcaagcgcatttcctttattgttattatttttagatgaattttgatgtgtagttcatgacttcatgtgaatttgtgtgaaatgtgctttgtgattggctttgctgatgcagacggggcaagtttactacatcaactgggaggacggcacccggacgaccatcgatccgcgctcgtcgtcggcgtactcgccgtcgccggcgtcgcggtccgcgtcgtcctcctcccgccgctgctcgcgcgcgcggggccgcggcggcggaggcggcgccgccgccgcggcgtcgaccaccacgtcgtcggggtacacctccgtgtcgtccgtgggcgcggtcaccgcggcggcggcggcgtggcgctcgcacgacagcagcgggcacggctacggctacggctacggctacggcagctatggctacggctacggctacgacggccgcgacggcgacgacgaggagagcagcagcagcagtagcagcagcagcagcagcagcagcagcgccagcagcagccggggctccgccgtgtcgtccacgctctcgtcgttctcccccaccgacgagtcggcctccggcgccggcagcggctacgccgtcggcgacaacggcgcccacgtcctcgtcgccgccggctgccgggcttgcttcatgtacttcatggtgccgaagaccgccgacgtgtgccccaagtgcggcagctccggcctcctccacctcagccgcaacggctacgtctga</dnaseqindica>|
| + | |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053492.2 RefSeq:Os02g0516400]|
| + | ==Structured Information== |
| − | }}
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]]
| |
| − | [[Category:Japonica Chromosome 2]] | |
| − | [[Category:Chromosome 2]]
| |
Please input one-sentence summary here.
Annotated Information
Function
CFL1 encodes a WW domain protein, and there are two homologs of rice CFL1in Arabidopsis:At CFL1 and At CFL2. Arabidopsisplants overexpressing AtCFL1displayed
organ fusion phenotypes with decreased levels of epicuticular wax and defective cuticles. Loss-of- CFL1-function resulted in an enhancement of cuticle properties in Arabidopsis. Biochemical evidence showed that At CFL1 interacts with HDG1, a class IV homeodomain-leucine zipper transcription factor. Suppression of HDG1 function resulted in similar defective cuticle phenotypes in wild-type Arabidopsis but much alleviated phenotypes in Atcfl1-1 mutants. The expression of two cuticle development-associated genes,BDGand FDH, was downregulated in At CFL1 overexpress or and HDG1 suppression plants. HDG1 binds to the cis-element L1 box, which exists in the regulatory regions of BDGand FDH. rice and Arabidopsis CFL1 negatively regulate cuticle development by affecting the function of HDG1, which regulates the downstream genes BDGand FDH.
Expression
At CFL1 was predominantly expressed in specialized epidermal cells and in regions where dehiscence and abscission occur.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
State Key Laboratory for Protein and Plant Gene Research, College of Life Sciences, Peking University
Institut fur Zellulare and Molekulare Botanik, Universitat Bonn
The National Plant Gene Research Center (Beijing)
References
Renhong Wu, et al. CFL1, a WW Domain Protein, Regulates Cuticle Development by Modulating the Function of HDG1, a Class IV Homeodomain Transcription Factor, in Rice and Arabidopsis. The Plant Cell, 2011, 23(9): 3392-3411
Structured Information