Difference between revisions of "Os02g0624300"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(8 intermediate revisions by one other user not shown)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
 +
===Function===
 
The MYB superfamily is one of the largest plant families (Stracke et al. 2001). MYB proteins are characterized by a conserved  MYB  DNA-binding  domain,  which  generally includes 1 to 3 imperfect repeats of 50–53 amino acids in the N-terminal region. Based on the number of adjacent repeats  in  the  binding  domain,  plant  MYB  proteins  are divided into 3 major groups: R1R2R3-MYB, R2R3-MYB, and R1-MYB (Kranz et al. 2000).  e functions of MYB proteins in plants are very diverse. Some plant MYB genes are  involved  in  the  regulation  of  secondary  metabolism, cellular  morphogenesis,  and  cell  cycle  (Ma  et  al.  2009), while others play important roles in the signal transduction responding to plant growth regulators, pathogen infection,and  drought  (Martin  and  Paz  1997;  Dai  et  al.  2007).  
 
The MYB superfamily is one of the largest plant families (Stracke et al. 2001). MYB proteins are characterized by a conserved  MYB  DNA-binding  domain,  which  generally includes 1 to 3 imperfect repeats of 50–53 amino acids in the N-terminal region. Based on the number of adjacent repeats  in  the  binding  domain,  plant  MYB  proteins  are divided into 3 major groups: R1R2R3-MYB, R2R3-MYB, and R1-MYB (Kranz et al. 2000).  e functions of MYB proteins in plants are very diverse. Some plant MYB genes are  involved  in  the  regulation  of  secondary  metabolism, cellular  morphogenesis,  and  cell  cycle  (Ma  et  al.  2009), while others play important roles in the signal transduction responding to plant growth regulators, pathogen infection,and  drought  (Martin  and  Paz  1997;  Dai  et  al.  2007).  
 
Given the size of the gene family and their roles in plant speci c  processes,  the  MYB  family  is  considered  to  be particularly important in the transcriptional regulation of plants (Jin and Martin 1999; Shuichi et al. 2011).Arizona ash is a member of the family Oleaceae, which is one of the most important trees in the world. Since Arizona ash is characterized by its ability to tolerate drought and salt conditions, it is widely planted in many areas (Balok and Hilaire  2002).In  Arizona  ash,  few  MYB  genes  have  been studied in detail due to its huge and complex genome.The molecular mechanisms of salt tolerance in Arizona ash are not yet clear.
 
Given the size of the gene family and their roles in plant speci c  processes,  the  MYB  family  is  considered  to  be particularly important in the transcriptional regulation of plants (Jin and Martin 1999; Shuichi et al. 2011).Arizona ash is a member of the family Oleaceae, which is one of the most important trees in the world. Since Arizona ash is characterized by its ability to tolerate drought and salt conditions, it is widely planted in many areas (Balok and Hilaire  2002).In  Arizona  ash,  few  MYB  genes  have  been studied in detail due to its huge and complex genome.The molecular mechanisms of salt tolerance in Arizona ash are not yet clear.
 +
Three  OsMYBSs  were  involved  in  the  sugar and  hormonal  regulation  of  α-amylase  gene  expression in  cereals  (Lu  et  al.  2002),  and  the  StMYB1R-1  protein, which functioned as a transcription factor involved in the activation of drought-related genes, can enhance drought tolerance via regulation of water loss (Dong et al. 2011). Several  plant  miRNAs  regulate  the  expression  of  MYB genes, and speci cally repress the target gene transcripts (Eldem et al. 2012). For example, the myb33 and myb101 mRNAs regulating seed germination could be suppressed by  miR159  activity.  Over-expression  of  miR159  resultedin  hyposensitivity  to  abscisic  acid  (ABA)  during  seed germination (Jung et al. 2009). Some single-MYB proteins were essential for maintaining telomere length or playing diverse roles in trichome development (Bilaud et al. 1996; Shakirov et al. 2005; Katja et al. 2009).
  
 
===Expression===
 
===Expression===
Line 11: Line 14:
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File:q.jpg]]The phylogenetic tree was constructed by neighbor-joining method (Saitou and Nei 1987) based on the R3 domain amino acid sequence.The  reliability  of  the  tree  was  measured  by  bootstrap  analysis  with  1000  replicates  (Felsenstein  1985).  Numbers  indicated similarity.The  amino  acid  sequences  were  obtained  from  NCBI  with  the  accession  numbers  as  below:  Arabidopsis  thaliana  MYBL2 (AEE35154),  AtETC1  (AEE27280),  AtTRY  (AED96321),  AtCPC  (AEC10691),  AtTCL1  (AEC08388),  AtMYB60  (AEE28351),  AtMYB2 (BAB62130), AtMYB15 (AEE76740); Oryza sativa OsMYB2 (BAA23338), OsMYB4 (Q7XBH4); Catharanthus roseus CrMYB (ABL63124);
 
+
Glycine max GmMYB176 (ABH02865), Rosa hybrid cultivar RhMYB (ABU53684), Oryza sativa Japonica Group OsMYBS2(AAN63153), OsMYBS3 (AAN63154); Malus xiaojinensis MxMYB1 (AAO45179); Solanum tuberosum StMYB1R-1 (Q2V9B0).
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
College of Life Science, Shandong Normal University, Shandong, P.R. China
 +
Shandong Provincial Key Laboratory of Genetic Improvement
 +
Ecology and Physiology of Crops and Key Laboratory of Crop Genetic
 +
Improvement and Biotechnology, Huanghuaihai, Ministry of Agriculture, Hi-Tech Research Center, Shandong
 +
Academy of Agricultural Science, Shandong, P.R. China
 +
Shandong Provincial Key Laboratory of Eco-Environmental Science for Yellow River Delta, Binzhou University, Shandong, P.R. China
  
 
==References==
 
==References==
Please input cited references here.
+
Balok  CA,  Hilaire  RS  (2002)  Drought  responses  among  seven southwestern  landscape  tree  taxa.  J  Am  Soc  Hortic  Sci  127: 211–218.
 +
Boyer LA, Latek RR, Peterson CL (2004)  e SANT domain: a unique histone-tail-binding module. Nat Rev Mol Cell Bio 5: 158–163.
 +
Dai  X,  Xu  Y,  Ma  Q,  Xu  W,  Wang  T,  Xue  Y,  Kang  C  (2007) Overexpression  of  an  R1R2R3  MYB  gene,  OsMYB3R-2, increases  tolerance  to  freezing,  drought,  and  salt  stress  in transgenic Arabidopsis. Plant Physiol 143: 1739–1751.
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0624300|
 
Description = Similar to Y19 protein|
 
Version = NM_001054009.1 GI:115447388 GeneID:4330027|
 
Length = 1156 bp|
 
Definition = Oryza sativa Japonica Group Os02g0624300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:25765638..25766793|
 
CDS = 25765777..25766290,25766409..25766671|
 
GCID = <gbrowseImage1>
 
name=NC_008395:25765638..25766793
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:25765638..25766793
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggggagggcgccgtgctgcgagaagatggggctgaagagggggccgtggacggcggaggaggacaggatcctggtggcgcacatcgagcggcacgggcacagcaactggcgcgcgctgccgaggcaggccggccttctccgctgcggcaagagctgccgcctccggtggatcaactacctccgccccgacatcaagcgcggcaacttcacccgcgaggaggaggacgccatcatccacctccacgaccttctcggcaaccgatggtccgcgattgcagcgaggctgccggggaggacggacaacgagatcaagaatgtgtggcacactcacctcaagaagcggctggagccgaagccgtcgtccggccgggaagccgccgcgcccaagcgaaaggcgaccaagaaggctgcggcggtggcggtggcgatcgacgttccgaccaccgtgccggtgtcgccggagcagtcgctctcgaccacgacgacgtcggccgccaccaccgaggagtactcgtactcgatggcctcctccgcggatcacaacaccacggacagtttcacctcggaggaggagttccagatcgacgacagcttctggtcggagacgctggcaatgacggtggacagcaccgactccgggatggagatgagcggcggcgatcctctcggcgcgggcggtgcctcgccgtcgtcgagcaacgacgacgacatggacgacttctggctcaagctgttcatccaggccggtggcatgcagaatttgccccagatttaa</cdnaseq>|
 
AA = <aaseq>MGRAPCCEKMGLKRGPWTAEEDRILVAHIERHGHSNWRALPRQA                    GLLRCGKSCRLRWINYLRPDIKRGNFTREEEDAIIHLHDLLGNRWSAIAARLPGRTDN                    EIKNVWHTHLKKRLEPKPSSGREAAAPKRKATKKAAAVAVAIDVPTTVPVSPEQSLST                    TTTSAATTEEYSYSMASSADHNTTDSFTSEEEFQIDDSFWSETLAMTVDSTDSGMEMS                    GGDPLGAGGASPSSSNDDDMDDFWLKLFIQAGGMQNLPQI</aaseq>|
 
DNA = <dnaseqindica>504..1017#123..385#gcatcacacagacgacgcagcatcagcaacacacacacacaccgagcaatcaatccatcacacacaaacacaaacaaacgcacagggcgcgagagctcgaacgagaggaggaaaggtcggcaatggggagggcgccgtgctgcgagaagatggggctgaagagggggccgtggacggcggaggaggacaggatcctggtggcgcacatcgagcggcacgggcacagcaactggcgcgcgctgccgaggcaggccggccttctccgctgcggcaagagctgccgcctccggtggatcaactacctccgccccgacatcaagcgcggcaacttcacccgcgaggaggaggacgccatcatccacctccacgaccttctcggcaaccggtacttttcaagccactgtccaatactagtttactaatcttttgccttggatacgcgaaagattttgtctcggatttgtttattggttaattaactcgatttgtggcgaatgattcagatggtccgcgattgcagcgaggctgccggggaggacggacaacgagatcaagaatgtgtggcacactcacctcaagaagcggctggagccgaagccgtcgtccggccgggaagccgccgcgcccaagcgaaaggcgaccaagaaggctgcggcggtggcggtggcgatcgacgttccgaccaccgtgccggtgtcgccggagcagtcgctctcgaccacgacgacgtcggccgccaccaccgaggagtactcgtactcgatggcctcctccgcggatcacaacaccacggacagtttcacctcggaggaggagttccagatcgacgacagcttctggtcggagacgctggcaatgacggtggacagcaccgactccgggatggagatgagcggcggcgatcctctcggcgcgggcggtgcctcgccgtcgtcgagcaacgacgacgacatggacgacttctggctcaagctgttcatccaggccggtggcatgcagaatttgccccagatttaatttaggcagagaattggcctcttgggtcgatctcttgttcatttttcttaccaccactattctttgaatctttggagctgtgtaaatctttacaaagcggagagattgatgggaaacgaaagaaggcaatattatcttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054009.1 RefSeq:Os02g0624300]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 06:43, 14 May 2015

Please input one-sentence summary here.

Annotated Information

Function

The MYB superfamily is one of the largest plant families (Stracke et al. 2001). MYB proteins are characterized by a conserved MYB DNA-binding domain, which generally includes 1 to 3 imperfect repeats of 50–53 amino acids in the N-terminal region. Based on the number of adjacent repeats in the binding domain, plant MYB proteins are divided into 3 major groups: R1R2R3-MYB, R2R3-MYB, and R1-MYB (Kranz et al. 2000). e functions of MYB proteins in plants are very diverse. Some plant MYB genes are involved in the regulation of secondary metabolism, cellular morphogenesis, and cell cycle (Ma et al. 2009), while others play important roles in the signal transduction responding to plant growth regulators, pathogen infection,and drought (Martin and Paz 1997; Dai et al. 2007). Given the size of the gene family and their roles in plant speci c processes, the MYB family is considered to be particularly important in the transcriptional regulation of plants (Jin and Martin 1999; Shuichi et al. 2011).Arizona ash is a member of the family Oleaceae, which is one of the most important trees in the world. Since Arizona ash is characterized by its ability to tolerate drought and salt conditions, it is widely planted in many areas (Balok and Hilaire 2002).In Arizona ash, few MYB genes have been studied in detail due to its huge and complex genome.The molecular mechanisms of salt tolerance in Arizona ash are not yet clear. Three OsMYBSs were involved in the sugar and hormonal regulation of α-amylase gene expression in cereals (Lu et al. 2002), and the StMYB1R-1 protein, which functioned as a transcription factor involved in the activation of drought-related genes, can enhance drought tolerance via regulation of water loss (Dong et al. 2011). Several plant miRNAs regulate the expression of MYB genes, and speci cally repress the target gene transcripts (Eldem et al. 2012). For example, the myb33 and myb101 mRNAs regulating seed germination could be suppressed by miR159 activity. Over-expression of miR159 resultedin hyposensitivity to abscisic acid (ABA) during seed germination (Jung et al. 2009). Some single-MYB proteins were essential for maintaining telomere length or playing diverse roles in trichome development (Bilaud et al. 1996; Shakirov et al. 2005; Katja et al. 2009).

Expression

The 4-week-old seedlings were transferred into Hoagland's solution with salt (300 mM) for 24 h. e seedlings grown on Hoagland’s solution were used as control.The roots, stems, cotyledons, and leaves were harvested separately and total RNA was reverse transcribed. e synthesized cDNA was used as template in semiquantitative RT-PCR and real-time PCR. For semiquantitative RT-PCR, the resulting cDNA was used as a template for 25 cycles of 30 s at 94 °C, 30 s at 58 °C, 30 s at 72 °C, and a nal extension at 72 °C for 10 min. Ten microliters of the PCR product were electrophoresed and visualized by ethidium bromide staining. Actin was used as a loading control. Primers used in semiquantitative RT-PCR were as follows: forward primer 5′-AGGGTTCATGCTGTTTGG-3′ and reverse primer 5′-GCTATTGTTGTTG GGTGGT-3′. Normalization was carried out by ampli cation of actin mRNA using a forward primer AF: 5′-TCCTCTTCCAGCCTTCTTT-3′ and a reverse primer AR: 5′-TTCCTT GCTCATACGGTCA-3′.Real-time PCR was also conducted using a BIORAD IQ5 (BioRad, USA) qPCR machine and the Maxima SYBR Green qPCR Master Mix (Fermentas) with primers Q-M1F (5′-TGTCGGGTTTCCAGACAATGCAA-3′) and Q-M1R (5′-TTTTCCCCCAACTTTCCAACACA-3′) for FvMYB1. Actin gene was used as housekeeping gene to normalize the target gene quantities.The same primers AF and AR were used for ampli cation of actin gene.The PCR annealing temperature of all primers was 60 °C.The expression level of the FvMYB1 gene was evaluated with respect to actin, which was constitutively expressed.

Evolution

Q.jpgThe phylogenetic tree was constructed by neighbor-joining method (Saitou and Nei 1987) based on the R3 domain amino acid sequence.The reliability of the tree was measured by bootstrap analysis with 1000 replicates (Felsenstein 1985). Numbers indicated similarity.The amino acid sequences were obtained from NCBI with the accession numbers as below: Arabidopsis thaliana MYBL2 (AEE35154), AtETC1 (AEE27280), AtTRY (AED96321), AtCPC (AEC10691), AtTCL1 (AEC08388), AtMYB60 (AEE28351), AtMYB2 (BAB62130), AtMYB15 (AEE76740); Oryza sativa OsMYB2 (BAA23338), OsMYB4 (Q7XBH4); Catharanthus roseus CrMYB (ABL63124); Glycine max GmMYB176 (ABH02865), Rosa hybrid cultivar RhMYB (ABU53684), Oryza sativa Japonica Group OsMYBS2(AAN63153), OsMYBS3 (AAN63154); Malus xiaojinensis MxMYB1 (AAO45179); Solanum tuberosum StMYB1R-1 (Q2V9B0).

Labs working on this gene

College of Life Science, Shandong Normal University, Shandong, P.R. China Shandong Provincial Key Laboratory of Genetic Improvement Ecology and Physiology of Crops and Key Laboratory of Crop Genetic Improvement and Biotechnology, Huanghuaihai, Ministry of Agriculture, Hi-Tech Research Center, Shandong Academy of Agricultural Science, Shandong, P.R. China Shandong Provincial Key Laboratory of Eco-Environmental Science for Yellow River Delta, Binzhou University, Shandong, P.R. China

References

Balok CA, Hilaire RS (2002) Drought responses among seven southwestern landscape tree taxa. J Am Soc Hortic Sci 127: 211–218. Boyer LA, Latek RR, Peterson CL (2004) e SANT domain: a unique histone-tail-binding module. Nat Rev Mol Cell Bio 5: 158–163. Dai X, Xu Y, Ma Q, Xu W, Wang T, Xue Y, Kang C (2007) Overexpression of an R1R2R3 MYB gene, OsMYB3R-2, increases tolerance to freezing, drought, and salt stress in transgenic Arabidopsis. Plant Physiol 143: 1739–1751.

Structured Information