Difference between revisions of "Os02g0650300"

From RiceWiki
Jump to: navigation, search
(Function)
 
(One intermediate revision by one other user not shown)
Line 4: Line 4:
 
===Function===
 
===Function===
  
Our results suggest that OsYSL16 plays a role in the allocation of iron(III)-deoxymugineic acid via the vascular bundles<ref name="pmid:22644443"/>.
+
OsYSL15 promoter-β-glucuronidase analysis revealed that OsYSL15 expression in roots was dominant in the epidermis/exodermis and phloem cells under conditions of iron deficiency and was detected only in phloem under iron sufficiency. These results strongly suggest that OsYSL15 is the dominant iron(III)-deoxymugineic acid transporter responsible for iron uptake from the rhizosphere and is also responsible for phloem transport of iron. OsYSL15 was also expressed in flowers, developing seeds, and in the embryonic scutellar epithelial cells during seed germination. OsYSL15 knockdown seedlings showed severe arrest in germination and early growth and were rescued by high iron supply. These results demonstrate that rice OsYSL15 plays a crucial role in iron homeostasis during the early stages of growth.
 
 
In the vascular bundles of unelongated nodes, it was detected in the xylem of old leaves and the phloem of new leaves<ref name="pmid:22644443"/>.
 
 
 
These results strongly suggest that OsYSL15 is the dominant iron(III)-deoxymugineic acid transporter responsible for iron uptake from the rhizosphere and is also responsible for phloem transport of iron<ref name="pmid:19049971"/>.
 
 
 
The expression of several genes encoding late embryogenesis abundant proteins, including Osem, was induced in Fe-deficient roots and/or leaves in an IDEF1-dependent manner, suggesting a possible function of seed maturation-related genes in Fe-deficient vegetative organs<ref name="pmid:19737364"/>.
 
 
 
Expression of the OsYSL16 promoter fused to the β-glucuronidase gene showed that OsYSL16 is expressed in the root epidermis and vascular bundles of whole plants<ref name="pmid:22644443"/>.
 
 
 
Graminaceous plants take up iron through YS1 (yellow stripe 1) and YS1-like (YSL) transporters using iron-chelating compounds known as mugineic acid family phytosiderophores<ref name="pmid:19049971"/>.
 
 
 
OsYSL16 plays a role in the allocation of iron<ref name="pmid:22644443"/>.
 
 
 
Graminaceous plants acquire iron by secreting mugineic acid family phytosiderophores into the rhizosphere and taking up complexes of iron and phytosiderophores through YSL (yellow stripe 1-like) transporters<ref name="pmid:22644443"/>.
 
 
 
Rice OsYSL15 is a transporter of the iron(III)-2'-deoxymugineic acid complex<ref name="pmid:22644443"/>.
 
  
 
Rice OsYSL15 is an iron-regulated iron(III)-deoxymugineic acid transporter expressed in the roots and is essential for iron uptake in early growth of the seedlings<ref name="pmid:19049971"/>.
 
Rice OsYSL15 is an iron-regulated iron(III)-deoxymugineic acid transporter expressed in the roots and is essential for iron uptake in early growth of the seedlings<ref name="pmid:19049971"/>.
Line 50: Line 34:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0650300|
 
Description = Oligopeptide transporter OPT superfamily protein|
 
Version = NM_001186167.1 GI:297721466 GeneID:9268232|
 
Length = 1969 bp|
 
Definition = Oryza sativa Japonica Group Os02g0650300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:27086997..27088965|
 
CDS = 27088433..27088646,27088748..27088911|
 
GCID = <gbrowseImage1>
 
name=NC_008395:27086997..27088965
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:27086997..27088965
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>actaattctgcaatctgcattcatgacagattgcaactccatgggtttctaaaatattttgggcttagcttattttggagcttcttccaatggttctacacgggaggcaatgcctgtggatttgttcagttccctacttttggtctgaaagcctggaaacaatcattcttctttgattttagcctcacatatgttggtgcggggatgatttgctcacaccttgtgaacctctctaccctccttggtgcggtcatttcatggggaataatgtggccacttatcagcaaacataagggggactggtaccctgcaaacatacctgaaagcagcatgacaagtttgtatggttacaaggtctcatattttctcaatgcttaa</cdnaseq>|
 
AA = <aaseq>TNSAICIHDRLQLHGFLKYFGLSLFWSFFQWFYTGGNACGFVQF                    PTFGLKAWKQSFFFDFSLTYVGAGMICSHLVNLSTLLGAVISWGIMWPLISKHKGDWY                    PANIPESSMTSLYGYKVSYFLNA</aaseq>|
 
DNA = <dnaseqindica>320..533#55..218#aattaattgtgctcattgcattattcttgttagacagtcgttgaccctaaatgaactaattctgcaatctgcattcatgacagattgcaactccatgggtttctaaaatattttgggcttagcttattttggagcttcttccaatggttctacacgggaggcaatgcctgtggatttgttcagttccctacttttggtctgaaagcctggaaacaatcgtaagaattatatgctaatttcctaattgttcatcacagatttatataaattgtagcatgcggtgacaaattttctaagtctgaatttgtttggatatcagattcttctttgattttagcctcacatatgttggtgcggggatgatttgctcacaccttgtgaacctctctaccctccttggtgcggtcatttcatggggaataatgtggccacttatcagcaaacataagggggactggtaccctgcaaacatacctgaaagcagcatgacaagtttgtatggttacaaggtctcatattttctcaatgcttaatgtaaaagcagatactacttacaaaaccatcagataacttatgtaaattgctccttttgcagtcgtttttatgcattgctctgattatgggggatggcctgtaccattttgttaaagttaccggtgtcactgctaagagtttacataatagatttaaccgaaaaagtgttagcaacacaggtgagaaaatgaaaccattgcaaattcaactacatggaaatggaatgcctctcacactcttccatcaccttaattttcacatactcataacactgttaatgatggctaaatgaaatgaattgcagcatcagaggagggtgatatggtttcattagatgatctacaacgtgatgaggtattcaagaggggtactgtcccttcttggatggcatacagtggttacttcttgctaagcatcattgcggtaatcaccataccgataatgtttcgacaagtgaagtggtactacgtgatcatagcctacgcgctcggcccggtgctaggattcgccaattcctacggagcagggctcacggacatcaacatggggtacaactacggcaagatcgctctcttcgtctttgcagcttgggctggcaaggacaatggcgtcatagccggccttgtggttggcaccctggtgaagcagctggtgctcgtctctgccgatctgatgcacgatctcaagacgggacatctcaccttgacatcgccgaggtccatgctcgtgggagagctcatcgggacaggcattggctgcttcatcgcgccactgacgttcatgctgttctacagggcgtttgacatcgggaaccccgatggctactggaaggcgccatacgcgctgatctaccgcaacatggcgatcctcgggatcgagggcatctcggcgctgcccaagcactgcctctcgctctccgtcgggttcttcgcgttcgccgtgctcacgaacgtggcgagggacgccctgccggcgaggtacaagaagctcgtgccgctgccgacggcgatggccgtgccgttcctcgtaggggcgagcttcgccatcgacatgtgcgtcgggagcctggtgctgtttgcttggaacaagatgaacaagaaggaggctgccttcatggtgcctgctgttgcgtctgggctcatgtgtggcgatggcatttggaccttcccttcttctatccttgctctcgctaagattaagccaccgatctgcatgaagtttacgcctggaagctaagaggtgtagtgtgtttaatttcatgggtggaggattgcagaaataaacagtgatgattaactgtaaatgtgtcttttggttgtagtgagctgctgtttgcctatgatccaagtcatgtttgtgttttaatttacctatcgaattagctgtgtttgtacacttgtacattttataacttgagaattgtttagtttggcat</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186167.1 RefSeq:Os02g0650300]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 06:44, 14 May 2015

Please input one-sentence summary here.

Annotated Information

Function

OsYSL15 promoter-β-glucuronidase analysis revealed that OsYSL15 expression in roots was dominant in the epidermis/exodermis and phloem cells under conditions of iron deficiency and was detected only in phloem under iron sufficiency. These results strongly suggest that OsYSL15 is the dominant iron(III)-deoxymugineic acid transporter responsible for iron uptake from the rhizosphere and is also responsible for phloem transport of iron. OsYSL15 was also expressed in flowers, developing seeds, and in the embryonic scutellar epithelial cells during seed germination. OsYSL15 knockdown seedlings showed severe arrest in germination and early growth and were rescued by high iron supply. These results demonstrate that rice OsYSL15 plays a crucial role in iron homeostasis during the early stages of growth.

Rice OsYSL15 is an iron-regulated iron(III)-deoxymugineic acid transporter expressed in the roots and is essential for iron uptake in early growth of the seedlings[1].

Furthermore, OsYSL16-knockdown plants accumulated more iron in the vascular bundles of the leaves[2].

The rice transcription factor IDEF1 is essential for the early response to iron deficiency, and induces vegetative expression of late embryogenesis abundant genes[3].

Proximal regions of IDEF1-regulated gene promoters also showed enrichment of RY elements (CATGCA), which regulate gene expression during seed maturation[3].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. Inoue, H; Kobayashi, T; Nozoye, T; Takahashi, M; Kakei, Y; Suzuki, K; Nakazono, M; Nakanishi, H; Mori, S; Nishizawa, NK. (2009) Rice OsYSL15 is an iron-regulated iron(III)-deoxymugineic acid transporter expressed in the roots and is essential for iron uptake in early growth of the seedlings.The Journal of biological chemistry 284: 6.
  2. Kakei, Y; Ishimaru, Y; Kobayashi, T; Yamakawa, T; Nakanishi, H; Nishizawa, NK. (2012) OsYSL16 plays a role in the allocation of iron.Plant molecular biology 79: 6.
  3. 3.0 3.1 Kobayashi, T; Itai, RN; Ogo, Y; Kakei, Y; Nakanishi, H; Takahashi, M; Nishizawa, NK. (2009) The rice transcription factor IDEF1 is essential for the early response to iron deficiency, and induces vegetative expression of late embryogenesis abundant genes.The Plant journal : for cell and molecular biology 60: 6.

Structured Information