|
|
| (22 intermediate revisions by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | Os02g0669000 gene is an protein-coding gene of rice, who's organism name is Oryza sativa Japonica Group. Os02g0669000 has the ID 4330264 in NCBI Gene Bank, and it's internal genotype ID is 1330276. |
| − | Os02g0669000 gene is an protein coding gene | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | Os02g0669000 can encode GDSL domain containing protein such as Lipase (Lipolytic enzyme) and GDSL family protein. Os02g0669000 protein also called putative anter-specific proline-rich protein, which function is expressing GDSL-like lipase/acylhydrolase super family protein . This Os02g0669000 gene participate in biological process such as lipid metabolic process, it also has molecular function like hydrolase activity, and acting on ester bonds. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | Os02g0669000 can express GDSL-like lipase/acylhydrolase protein.Os02g0669000 has many coexpressed genes, such as Os1g0198200 which encode conserved hypothetical protein, Os02g0291000 which encodes EF-Hand type domain containing protein. |
| | + | |
| | + | The top 20 coexpressed genes (in field leaf samples): |
| | + | [[File: li-Os02g0669000-Fig1.png||right|thumb|200px|''The top 20 coexpressed genes (in field leaf samples). '']] |
| | | | |
| | + | Os02g0669000 co-expression analysis, find that it has homology with Arabidopsis, similiar to At3g18740: 60s ribosomal protein L30 (RPL 30C). |
| | + | The fragment of RNA gene and IR GSP gene showed below: |
| | + | [[File: li-Os02g0669000-Fig2.png|right|thumb|200px|''The fragment of RNA gene and IR GSP gene. '']] |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | Os02g0669000 has two transcript variants: Os02t0669000-01,Os02t0669000-02,These transcripts are products of gene OS02g0669000. |
| | + | Name Transcript ID Length(bp) Protein ID Length(aa) Biotype |
| | + | P0684A08.8-201 Os02t0669000-01 1452 Oso2t0669000-01 376 Protein coding |
| | | | |
| − | You can also add sub-section(s) at will.
| + | Analyse and create the gene tree, conclude the information of the gene tree: |
| | + | Number of genes: 367 |
| | + | Number of speciation nodes: 258 |
| | + | Number of duplication: 102 |
| | + | Number of ambiguous: 0 |
| | + | Number of gene split events: 6 |
| | + | [[File: li-Os02g0669000-Fig2.jpeg|right|thumb|200px|''gene tree. '']] |
| | + | We also has the detail information about Os02g0669000’s co-expressed gene tree(HyperTree),which can be found in link: http://ricefrend.dna.affrc.go.jp/HyperTree/index.php?id=11509&rank=3&mr=7 |
| | + | [[File: li-Os02g0669000-Fig4.jpeg|right|thumb|200px|''HyperTree. '']] |
| | + | Search on all the database and figure out that there is no differential expression were found for Os02g669000. |
| | + | ===Alignments and location of this gene=== |
| | + | Give the information of genomic alignments of Oryza sativa Japonica (Rice):[[File: li-Os02g0669000-Fig6.png|right|thumb|200px|''genomic alignments of Oryza sativa Japonica (Rice). '']] |
| | | | |
| − | ==Labs working on this gene==
| + | To tell apart Os02g0669000 to other genes, we search on the Rice TOGO Browser and then find Os02g0669000 has 1 loci found in chromosome, this position is chr02 28045214-28049582.As is shown in the figure below:[[File: li-Os02g0669000-Fig5.jpeg|right|thumb|200px|''The position of Os02g0669000 loci. '']] |
| − | Please input related labs here.
| |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | 1."Oryza sativa nipponbare(GA3) genomic DNA, chromosome 2, BAC clone:OJ1725_H08." |
| | + | Sasaki T., Matsumoto T., Yamamoto K. |
| | + | Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases |
| | + | 2."The map-based sequence of the rice genome." |
| | + | International rice genome sequencing project (IRGSP) |
| | + | Nature 436:793-800(2005) [PubMed] [Europe PMC] [Abstract] |
| | + | |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | GeneName = Os02g0669000|
| |
| − | Description = Lipolytic enzyme, G-D-S-L family protein|
| |
| − | Version = NM_001054223.1 GI:115447816 GeneID:4330264|
| |
| − | Length = 4369 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0669000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:28045214..28049582|
| |
| − | CDS = 28045535..28045761,28045844..28046093,28046186..28046422,28046506..28046636,28049297..28049540<br>|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:28045214..28049582
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:28045214..28049582
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggctggacagatgctaccgccgattgcgcttgttgctgtggccatctgtatcaccgcggcggcggcggcgaaggtgccggcgatatacgtgttcggcgactccacggccgatgtcggcaacaacaactacctgaccggcgccgccgtgccgcgggcaaacttcccgcacaacggcattgacttccccacgtcgcggcccaccggccggttcagcaacgggtacaacggcgtcgacttcttggctcttaacatgggattcaggcgcagccccccaccgttcctcgccgtggctaacaaaaccagcaacccattgttcagggggctccagggaacaaactttgcctctgcaggatcaggcattctcgactcaacaggtcaatccatcatcccaatgagcaagcaagtgcagcaattcgccgccgtgcaacgcaacatctcagcacgcatcagccagcaagccgctgacaccgtgctgtcgagatccctgttcctgatcagcaccggcggcaacgacatcttcgccttcttctccgcgaacagcacgccgtcgtccgcggagatgcagcggttcgtcaccaatctcgtatcgctctacacaaatcatgtcaaggatctgtacgttctcggggcgaggaagttcgccgtgatcgacgtcccgccgatcgggtgctgcccctacccgagaagcctgcaaccgctgggcgcttgcatcgacgtcctcaacgagctggcccgtgggttgaacaagggagtcaaggacgccatgcacggcctcagcgtgagcttcagcggcttcaagtactccatcgggagctcccatgccgtggtgcaaagcatcatgaagcatccccaacgactcggattcaaggaggtcacgacggcttgctgcggctccggcaagttcaacggcgagtccgggtgcacgccgaacgccacgctgtgcgacaaccggcacgactacctcttctgggacctgctgcacccgacgcacgccacgtccaagatcgccgccgcggccatatacaacggctcggtccgcttcgctgcgccgataaatttcaggcagctggtggatgaccagcactag</cdnaseq>|
| |
| − | AA = <aaseq>MAGQMLPPIALVAVAICITAAAAAKVPAIYVFGDSTADVGNNNY LTGAAVPRANFPHNGIDFPTSRPTGRFSNGYNGVDFLALNMGFRRSPPPFLAVANKTS NPLFRGLQGTNFASAGSGILDSTGQSIIPMSKQVQQFAAVQRNISARISQQAADTVLS RSLFLISTGGNDIFAFFSANSTPSSAEMQRFVTNLVSLYTNHVKDLYVLGARKFAVID VPPIGCCPYPRSLQPLGACIDVLNELARGLNKGVKDAMHGLSVSFSGFKYSIGSSHAV VQSIMKHPQRLGFKEVTTACCGSGKFNGESGCTPNATLCDNRHDYLFWDLLHPTHATS KIAAAAIYNGSVRFAAPINFRQLVDDQH</aaseq>|
| |
| − | DNA = <dnaseqindica>3822..4048#3490..3739#3161..3397#2947..3077#43..286#agcccccacccagagccagcggactgcacctcgcagtccggcatggctggacagatgctaccgccgattgcgcttgttgctgtggccatctgtatcaccgcggcggcggcggcgaaggtgccggcgatatacgtgttcggcgactccacggccgatgtcggcaacaacaactacctgaccggcgccgccgtgccgcgggcaaacttcccgcacaacggcattgacttccccacgtcgcggcccaccggccggttcagcaacgggtacaacggcgtcgacttcttgggtacgtacagcttcgccgcccgtctttcctgtgctgtattgcctcgcgactctgcttgccatgcgatgcgagtatacttcggcacttcgcggtatagtagcggctggcatcgttgcatatctgacaaccacgtatatagccggtgattgtttcgttttttctgcatgttttttgtcaacttcggcattgcaagttttgtaacggtgctagagttgagtaggggtgaagactggagacgattaagtcttcgtctctatactatttccgcggtccaattaccgaaggcaagaagtggaaattgctttgaaaacggagagattgtcgcatactccctccgtcccaaaaaaaaccaacaaaggttgtgccatactacctttgtaaaaaaaaaaactacggagagtatgtttagatttgtttttgttttatggatcatatcttatcttaatataacaatattttgagagggagtaaatagaacataaaaaatgttttgaagaagaaccccatacttcagaactgtgaagtgcgcaacgccagggcagtgtgccactgtggcgcacacattccagaggtcgcctatgcttaaatcgatagttggctcgttgctgcccgaattaaatttgaaaatatattgttaattcattttatttttagaaatattcgagatttattttttaaaaaaattataccgttgatcttgcacaatcattatgcgaatgtgaggtggtgcgacttcgcgggcggtatcgcgcgagactgcgcggtcttgcgaaatgaaagaacgataccagatttcaaaatggttaattagtgattaattattatgattagcaattattaagtaatcattaattattattagttaaatagttaattagatcattagtcactaaccaaatggagtttgggatggtgtcgctctctgcatgagcgagaccgctcgtcattcctgcgacagcgcgcggtcgtgcggtcgccccacgataccgtcgttgatgtcacccctatattatttttattttcggttgtatgagatcgactgtatatttctataaaaataaattacatcctaaatatttttaaaaataaaattgaatgaacagtatttttcaaatttaattcgctgctgctccacttccgcacggggcgcaggcacacaggctttgggaagcgatgcttgcaaagagtggcagtgtccggctgttggcaggcgggcgcggctgaatggaccgatcactcgagacttggcgcttgtcgcacataaatggctgacccgcttgcatgtactagccttgatccgggccaccacgcactcattgcatgtccgaattggtaccaaaatctacggcacacatgacaaatctacagcagacacgatctgacgtacggtccaacatcgaggtcatgcgatcgcctttttaagcgttgggactgtttgggatggagattgggagataatgccaaaatacgataatgtgagcagcgcacgtatttgaaaaattcaaatacattttttgctggcaaatgccttataaaagaaaataaagatttaatcgtacgcgaaacatcaacatcgataataaaattaatatttgtaactattatatatatatatatatattttccaatgtgatagcatcttaagatttcaggtatgatgaatacaatacacacacatttcgctttgttccgagtcgatctcgaagatcctattacaataatattataggtgtttttccttttttttatgttgtctagatgcggtttttctacatctaaatgtagttgcgcttagcgcgtctgtagcataatcgttttcgcgatgcgtactatattttcttctcatggtattgttttcctcaccaaacctgcggtggctagcctaggtgctaaaaggactttctcaaagcgtatgtcgttcattatatattttgacatgaggggtttggtcactggtggggagggtagggcaagaagcatggcggacctaggctcattggccatggaagagaccaagaagggccttggccatgcattaaatagaaggatggtgttgtggcctagagggagaaggaaggtgttttcgtcatgtactcttcttgcctgatatgtaatgtttctcagctgagaaccattgcttacatgtcgctaacttttccgatcaggaatggttaaatatcgaattccaatctataatgcttctccaacagttagagattgatcagtaaaggtttgacatatggatgaataatggtttcatgttagttaggctttatcgggatcattgcttctatagtagtaagagcgagtacaatagcagggtacaagtcagttgtaagcacatatggagaagagaagagaagagagataaagaagacgggctataaacttgtagccagttgcagcatggactataatacattgtgcatatgagaggtgggaccatatattaatggtgtagtatatacttataagtaactattgtatgaatgagctattagattggctataaataaattgaagctagtagttggctatactattaaacttgctctaatagttagtattattatggggaatgtgtaagccacgagcacggagtagcgcttgcatttttgttgtatatctcgaggatcacaatattcttcaacctctgtcagctcttaacatgggattcaggcgcagccccccaccgttcctcgccgtggctaacaaaaccagcaacccattgttcagggggctccagggaacaaactttgcctctgcaggatcaggcattctcgactcaacagtaagcacgtcggcataaacccaaagccactgcacgatttttcgctgaacaccggctgatgacgacgaaacacgtgtgtgcagggtcaatccatcatcccaatgagcaagcaagtgcagcaattcgccgccgtgcaacgcaacatctcagcacgcatcagccagcaagccgctgacaccgtgctgtcgagatccctgttcctgatcagcaccggcggcaacgacatcttcgccttcttctccgcgaacagcacgccgtcgtccgcggagatgcagcggttcgtcaccaatctcgtatcgctctacacaaatcatgtcaaggtaaaaccacctttcgcttgtctctcatcacacaattttacggcgaagaaacacaaagaatctaactgaaagttgacgcgtgagcgcggcaggatctgtacgttctcggggcgaggaagttcgccgtgatcgacgtcccgccgatcgggtgctgcccctacccgagaagcctgcaaccgctgggcgcttgcatcgacgtcctcaacgagctggcccgtgggttgaacaagggagtcaaggacgccatgcacggcctcagcgtgagcttcagcggcttcaagtactccatcgggagctcccatgccgtggtgcaaagcatcatgaagcatccccaacgactcggtatctgaacattctacgcttcagtttcggatttctgaccaacgcaaggttcagagtttcgtgacacggcattggtgtgcaggattcaaggaggtcacgacggcttgctgcggctccggcaagttcaacggcgagtccgggtgcacgccgaacgccacgctgtgcgacaaccggcacgactacctcttctgggacctgctgcacccgacgcacgccacgtccaagatcgccgccgcggccatatacaacggctcggtccgcttcgctgcgccgataaatttcaggcagctggtggatgaccagcactagctagagcgtggcagtgtcaccgtgtaacgtagtactactaattgttgtacgtcgccgactatgtgtctgtttgtctggtgatattggtgcgtaggatatgctgggctgtgttcatcagtggcttgtgctttaggcggtggtgtagtttggatacacataccaaaatgtcatctccgttattattgttgcccttgttggtatttgcggtgtttgtgttcccaagtcgggataatttgagcctggagcggatgagccaaggacatcgcagctgcttacttggtgccaaatcggaatacaaactctaaacatgtaggtacatac</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054223.1 RefSeq:Os02g0669000]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 2]]
| |
| − | [[Category:Chromosome 2]]
| |
Os02g0669000 gene is an protein-coding gene of rice, who's organism name is Oryza sativa Japonica Group. Os02g0669000 has the ID 4330264 in NCBI Gene Bank, and it's internal genotype ID is 1330276.
Annotated Information
Function
Os02g0669000 can encode GDSL domain containing protein such as Lipase (Lipolytic enzyme) and GDSL family protein. Os02g0669000 protein also called putative anter-specific proline-rich protein, which function is expressing GDSL-like lipase/acylhydrolase super family protein . This Os02g0669000 gene participate in biological process such as lipid metabolic process, it also has molecular function like hydrolase activity, and acting on ester bonds.
Expression
Os02g0669000 can express GDSL-like lipase/acylhydrolase protein.Os02g0669000 has many coexpressed genes, such as Os1g0198200 which encode conserved hypothetical protein, Os02g0291000 which encodes EF-Hand type domain containing protein.
The top 20 coexpressed genes (in field leaf samples):
The top 20 coexpressed genes (in field leaf samples).
Os02g0669000 co-expression analysis, find that it has homology with Arabidopsis, similiar to At3g18740: 60s ribosomal protein L30 (RPL 30C).
The fragment of RNA gene and IR GSP gene showed below:
The fragment of RNA gene and IR GSP gene.
Evolution
Os02g0669000 has two transcript variants: Os02t0669000-01,Os02t0669000-02,These transcripts are products of gene OS02g0669000.
Name Transcript ID Length(bp) Protein ID Length(aa) Biotype
P0684A08.8-201 Os02t0669000-01 1452 Oso2t0669000-01 376 Protein coding
Analyse and create the gene tree, conclude the information of the gene tree:
Number of genes: 367
Number of speciation nodes: 258
Number of duplication: 102
Number of ambiguous: 0
Number of gene split events: 6
We also has the detail information about Os02g0669000’s co-expressed gene tree(HyperTree),which can be found in link: http://ricefrend.dna.affrc.go.jp/HyperTree/index.php?id=11509&rank=3&mr=7
Search on all the database and figure out that there is no differential expression were found for Os02g669000.
Alignments and location of this gene
Give the information of genomic alignments of Oryza sativa Japonica (Rice):
genomic alignments of Oryza sativa Japonica (Rice).
To tell apart Os02g0669000 to other genes, we search on the Rice TOGO Browser and then find Os02g0669000 has 1 loci found in chromosome, this position is chr02 28045214-28049582.As is shown in the figure below:
The position of Os02g0669000 loci.
References
1."Oryza sativa nipponbare(GA3) genomic DNA, chromosome 2, BAC clone:OJ1725_H08."
Sasaki T., Matsumoto T., Yamamoto K.
Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
2."The map-based sequence of the rice genome."
International rice genome sequencing project (IRGSP)
Nature 436:793-800(2005) [PubMed] [Europe PMC] [Abstract]
Structured Information