|
|
| Line 26: |
Line 26: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | GeneName = Os02g0734400|
| |
| − | Description = Caleosin related family protein|
| |
| − | Version = NM_001054574.2 GI:297599890 GeneID:4330643|
| |
| − | Length = 1439 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0734400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:31518174..31519612|
| |
| − | CDS = 31518732..31518973,31519142..31519267,31519377..31519530|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:31518174..31519612
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:31518174..31519612
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgccctcggtaccaagaccagacctgtatgatctgtcacatctttatatatgtttcgtttggcgcataattcccctggttatgcgtgatataaagaaaaaaactgacagtttgtgctttttccaaatttccaaatgcacgcaggaaaatgcaacagcatcacggttttctatctatatagagaacatccacaaaggggtccatggaagtgatactggcgcattcgattcagaaggaaggtttgtcaatgaaaagttcgatgagatatttaccaagcatgcaaaaactgtacccgatggcctgacagcagccgaactggacgagatgcttcgtgcaaacagagaacccaaggactacaaaggatgggtcggagcatcgacggagtgggagacgacgttcaagctcgggaaggacaaggatggtttccttcgcaaggacactgtcagaactgtctacgatgggagcttcttcagtaaagtggcgtcgaagaagaagggtccctctgcaaaccaagcatga</cdnaseq>|
| |
| − | AA = <aaseq>MAPSVPRPDLYDLSHLYICFVWRIIPLVMRDIKKKTDSLCFFQI SKCTQENATASRFSIYIENIHKGVHGSDTGAFDSEGRFVNEKFDEIFTKHAKTVPDGL TAAELDEMLRANREPKDYKGWVGASTEWETTFKLGKDKDGFLRKDTVRTVYDGSFFSK VASKKKGPSANQA</aaseq>|
| |
| − | DNA = <dnaseqindica>559..800#969..1094#1204..1357#caacaaatggaggttcgtcgacgatggtcgtctccggcgacggctgcggccatggctctcgtcctgttcgcctcgtcgtcctcctgtaaacgccctgtaacacacaatatcctctgtggcacgcgcgcgtgcgtgcgcgtctgatttgttggtctcgtgtctcgttaatttgcttactcgatcgctacgttttccattacgaatttgcgatcgatccgaggaaagggagcccggcggcggcggcggcggttggcgctgcgacggaactgcagaagcacgtggcgttcttcgacagcaaccacgacggcatcatctccttctccgagacgtacgaaggtgggtggccatgcctgtcctatcctccgttttctgcttgctaaatgtcaaacgcagccttatatctcccttaaattgttacagcataatttcttttaatatgttgtttcaattcaagggagatctaagactgcattttgatattttttttaatggtgcctgcagggttccgtgcgctcggatttggagttgttacctccagattcagcgcgaccgtaatcaatggcgccctcggtaccaagaccagacctgtatgatctgtcacatctttatatatgtttcgtttggcgcataattcccctggttatgcgtgatataaagaaaaaaactgacagtttgtgctttttccaaatttccaaatgcacgcaggaaaatgcaacagcatcacggttttctatctatatagagaacatccacaaaggggtccatggaagtgatactggcgcattcgattcagaaggaaggtagtcatttcgtagactctccaaacagtaatgatacaagcgagttcagcaaattgccttggattgtctgaactgtttgcaacatagattattcttttacgttcttccacacatataattcacaatcatctttttgatatgctagtagtatattcaactctgctgcaggtttgtcaatgaaaagttcgatgagatatttaccaagcatgcaaaaactgtacccgatggcctgacagcagccgaactggacgagatgcttcgtgcaaacagagaacccaaggactacaaaggatggtaatctcttgctagctgatagcttcagaaaccatatgcatgtatatctgttcaaatggtctgctcactgtattcgcttgcactacttttgtaccacgagaaaatgcagggtcggagcatcgacggagtgggagacgacgttcaagctcgggaaggacaaggatggtttccttcgcaaggacactgtcagaactgtctacgatgggagcttcttcagtaaagtggcgtcgaagaagaagggtccctctgcaaaccaagcatgattgggattttggaaggaaaaatgtactaaattgatagaacatgtcaaggcatccctaaaatgaatggtccatatatatttac</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054574.2 RefSeq:Os02g0734400]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 2]]
| |
| − | [[Category:Chromosome 2]]
| |
Latest revision as of 06:49, 14 May 2015
Please input one-sentence summary here.
Annotated Information
Function
Os02g0734400 is a stress responsive gene. It encodes the caleosin which mainly lay in oil body or lipid body.These physiological and biochemical processes including regulation of genes involvedin stomatal closure, maintaining internal and external balance of water and ions,adjusting the synthesis and catabolism
Expression
Molecular weight of caleosins range from 15KD to 30KD.Caleosins have a significant feature that EF-hand domain in N-terminal can combine Ca2+,a central hydrophobic region and a security protein kinase phosphorylation sites in C-terminal.Caleosins's N-terminal and C-terminal are located in the cytoplasm,however central hydrophobic region are anchored in the phospholipid monolayer membrane.
Evolution
Drought stress response gene can be divided into two categories,namely,action or regulation during the early signal-regulated protein and advanced adaptive functional proteins which could affect activity of other proteins.Excavations and research in arid pathway for in-depth understand the mechanisms of plant drought, reducing the effects of drought, etc,are great significance
Os02g0734400 contains introns,it is described Os02g0734400 is not originated in retrotransposition events.It contains 6 extons.Through high density genetic maps,and combine the position information of the respective genomicoil body protein gene family of calcium,plotted on chromosome 6 relative positions of these oil-body protein gene of calcium.Os06g0254700 and Os02g0734400 are on the regionon of chromosome repilcation , which may be cause of chromosome replication.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
1 .Muhammad F, Abdul W, Dong J L, et al. Advances in drought resistance of rice. Crit Rev Plant Sci, 2009, 28: 199–217
2 .Zhang J H, Jia W S, Yang J C, etal. Role of ABA in integrating plant responses to drought and salt stresses. Field Crop Res, 2006, 97:
111–119
3 .Kant P, Gordon M, Kant S, et al. Functional genomics-based identification of genes that regulate Arabidopsisresponses to multiple abiotic
stresses. Plant Cell Environ, 2008, 31: 697–714
4 .Oono Y, Seki M, Nanjo T, et al. Monitoring expression profiles of Arabidopsis thalianagene expression during rehydration press after
dehydration using ca. 7000 full-length cDNA microarray. Plant J, 2003, 34: 868–887
Structured Information