Difference between revisions of "Os06g0181450"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os06g0181450| Description = Hypothetical protein| Version = NM_001187707.1 GI:297724544 GeneID:9267027| Length = 191 bp| Definition = Oryza sat...")
 
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
−
{{JaponicaGene|
+
Please input one-sentence summary here.
−
GeneName = Os06g0181450|
 
−
Description = Hypothetical protein|
 
−
Version = NM_001187707.1 GI:297724544 GeneID:9267027|
 
−
Length = 191 bp|
 
−
Definition = Oryza sativa Japonica Group Os06g0181450, complete gene.|
 
−
Source = Oryza sativa Japonica Group
 
  
−
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
−
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Function===
−
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
Please input function information here.
−
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
−
|
+
===Expression===
−
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
+
Please input expression information here.
−
AP = Chromosome 6:4021179..4021369|
+
 
−
CDS = 4021179..4021221,4021281..4021369|
+
===Evolution===
−
GCID = <gbrowseImage1>
+
Please input evolution information here.
−
name=NC_008399:4021179..4021369
+
 
−
source=RiceChromosome06
+
You can also add sub-section(s) at will.
−
preset=GeneLocation
+
 
−
</gbrowseImage1>|
+
==Labs working on this gene==
−
GSID = <gbrowseImage2>
+
Please input related labs here.
−
name=NC_008399:4021179..4021369
+
 
−
source=RiceChromosome06
+
==References==
−
preset=GeneLocation
+
Please input cited references here.
−
</gbrowseImage2>|
+
 
−
CDNA = <cdnaseq>atggcgtctgaagatatccaggcatttgagacgctcactggaagtcctacggaaggcatcgctactccactgaattctttgtttcctaccactttatctgacattccaaaacaggaacaggatagcacttaa</cdnaseq>|
+
==Structured Information==
−
AA = <aaseq>MASEDIQAFETLTGSPTEGIATPLNSLFPTTLSDIPKQEQDST</aaseq>|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 6]]
−
DNA = <dnaseqindica>149..191#1..89#atggcgtctgaagatatccaggcatttgagacgctcactggaagtcctacggaaggcatcgctactccactgaattctttgtttcctacgttatagctcatgccatgtggattgacccagattagcttcatatttcgatatgctgtagcactttatctgacattccaaaacaggaacaggatagcacttaa</dnaseqindica>|
 
−
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001187707.1 RefSeq:Os06g0181450]|
 
−
}}
 
−
[[Category:Genes]]
 
−
[[Category:Japonica mRNA]]
 
−
[[Category:Oryza Sativa Japonica Group]]
 
−
[[Category:Japonica Genes]]
 
−
[[Category:Japonica Chromosome 6]]
 
−
[[Category:Chromosome 6]]
 

Latest revision as of 08:48, 14 May 2015

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information