|
|
| (17 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. <ref name="ref1" /><ref name="ref3" />.
| + | Please input one-sentence summary here. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants<ref name="ref2" />.
| + | Please input function information here. |
| − | The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.<ref name="ref3" />
| |
| − | === Mutation ===
| |
| − | Please Mutation information here | |
| | | | |
| | ===Expression=== | | ===Expression=== |
| Line 20: |
Line 17: |
| | | | |
| | ==References== | | ==References== |
| − | <references>
| + | Please input cited references here. |
| − | <ref name="ref1">Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011</ref>
| |
| − | <ref name="ref2">Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from other plants .Plant Molecular Biology 13: 395-397, 1989.</ref>
| |
| − | <ref name="ref3">
| |
| − | Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial
| |
| − | Genome Evolution PLOS Genetics August 2012</ref>
| |
| − | == Structured Information ==
| |
| − | {{Mitochondrion|
| |
| − | GeneName = atp9|
| |
| − | Description = ATP synthase F0 subunit 9|
| |
| − | Version = GeneID:6450130|
| |
| − | Length = 225 bp|
| |
| − | Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| + | ==Structured Information== |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Mitochondrion]] |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
| |
| − | AP = Mitochondrion:263141..263365|
| |
| − | CDS = 263141..263365|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_011033:263141..263365
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_011033:263141..263365
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | AA = <aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>|
| |
| − | DNA <dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]]
| |
| − | [[Category:Japonica Mitochondrion]] | |
| − | [[Category:Mitochondrion]
| |