Difference between revisions of "Atp9"

From RiceWiki
Jump to: navigation, search
m (moved Atp9 to Atp9a)
 
(16 intermediate revisions by 2 users not shown)
Line 1: Line 1:
The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. <ref name="ref1" /><ref name="ref3" />.
+
Please input one-sentence summary here.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants<ref name="ref2" />.
+
Please input function information here.
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.<ref name="ref3" />
 
=== Mutation ===
 
Please Mutation information here
 
  
 
===Expression===
 
===Expression===
Line 20: Line 17:
  
 
==References==
 
==References==
<references>
+
Please input cited references here.
<ref name="ref1">Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011</ref>
 
<ref name="ref2">Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.</ref>
 
<ref name="ref3">
 
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial
 
Genome Evolution PLOS Genetics August 2012</ref>
 
== Structured Information ==
 
{{Mitochondrion|
 
GeneName = atp9|
 
Description = ATP synthase F0 subunit 9|
 
Version = GeneID:6450130|
 
Length = 225 bp|
 
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Structured Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Mitochondrion]]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
 
AP = Mitochondrion:263141..263365|
 
CDS = 263141..263365|
 
GCID = <gbrowseImage1>
 
name=NC_011033:263141..263365
 
source=Rice_Japonica_Mitochondrion
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_011033:263141..263365
 
source=Rice_Japonica_Mitochondrion
 
preset=GeneLocation
 
</gbrowseImage2>|
 
AA = <aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>|
 
DNA <dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Mitochondrion]]
 
[[Category:Mitochondrion]
 

Latest revision as of 05:34, 15 May 2015

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information