|
|
| (31 intermediate revisions by one other user not shown) |
| Line 4: |
Line 4: |
| | ===Function=== | | ===Function=== |
| | Please input function information here. | | Please input function information here. |
| − | The editing of the orfB
| |
| − | gene ~1.1 kb transcript co-segregated with fertility
| |
| − | restoring alleles in a segregating population of F2 progeny
| |
| − | of restored hybrid F1 plants.
| |
| | | | |
| | ===Expression=== | | ===Expression=== |
| | Please input expression information here. | | Please input expression information here. |
| − | Editing of the orfB transcripts
| |
| − | (a) The fertile line
| |
| − | Mitochondrial RNA editing of the orfB transcript was
| |
| − | assessed in the fertile rice line. Fourteen cDNA clones
| |
| − | obtained from cDNA library of fertile rice line were
| |
| − | sequenced. Determination of the orfB cDNA sequence
| |
| − | from overlapping clones from the cDNA library showed
| |
| − | four C®T conversions within the coding region relative
| |
| − | to the orfB genomic sequence.
| |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| Line 31: |
Line 18: |
| | ==References== | | ==References== |
| | Please input cited references here. | | Please input cited references here. |
| − | {{Mitochondrion|
| |
| − | GeneName = orfB|
| |
| − | Description = ORFB protein|
| |
| − | Version = GeneID:6450152|
| |
| − | Length = 468 bp|
| |
| − | Definition = Oryza sativa Japonica Group ''orfB'', Mitochondrion gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| + | ==Structured Information== |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Mitochondrion]] |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
| |
| − | AP = Mitochondrion:53424..53891|
| |
| − | CDS = 53424..53891|
| |
| − | GCID = <gbrowseImage3>
| |
| − | name=NC_011033:53424..53891
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage3>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_011033:53424..53891
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | AA = <aaseq>MPQLDKLTYFSQFFWLCLFFFSFYILLLNNNNGILGISRILKLRNQLLSHRGNKIRFKDPKNLEDILRKGFSTGLSYMYSSLSEVSQWCKTVDYLGKRRKITLISDFGEISGSRGMERQILYLISKSSYNTSSSRITCWKKIMLTHVLHGQGSII</aaseq>|
| |
| − | DNA = <dnaseqindica>1..468#atgcctcaacttgataaattgacttatttctcacaattcttctggttatgccttttcctctttagtttttatattctcttattaaataataataatggaatacttggaattagcagaattctcaaactacggaaccaactgctttcgcaccgggggaacaagatccgtttcaaggaccctaagaatttggaagatatctcgagaaaaggttttagcaccggtctctcatatatgtactccagtttatccgaagtatcccaatggtgtaagaccgtcgactatttgggaaaaaggaggaaaatcactctgatctcagatttcggagaaataagtggctcacgaggaatggagagacagattctctatttgatctcgaagtcctcatataacacttcttccagtcggatcacttgttggaaaaaaataatgctcacacatgttccacacgggcaaggaagcataatctaa</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/gene?term=6450152 NCBI Gene:orfB]
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Mitochondrion]]
| |
| − | [[Category:Mitochondrion]]
| |
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
