|
|
| (25 intermediate revisions by one other user not shown) |
| Line 3: |
Line 3: |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | Hypothetical protein
| + | Please input function information here. |
| − | | |
| − | ===Mutation===
| |
| − | Experimental evidence for polymorphisms in orfB structural organization and mitochondrial transcript profiles of the orfB gene in the CMS-WA rice system. The sterile line orfB gene transcript profile was characterized by two transcripts of ~1.1 kb and ~0.7 kb, and one ~0.7 kb transcript was detected in the fertile lines. The ~1.1 kb transcript present in the sterile line remained unedited. However, in the presence of nuclear encoded restoration of fertility (Rf) gene(s) in fertile restored hybrid lines (APMS-6A × BR-1870; F1 generation), the ~1.1 kb orfB transcripts were fully edited. The editing of the orfB gene ~1.1 kb transcript co-segregated with fertility restoring alleles in a segregating population of F2 progeny of restored hybrid F1 plants.
| |
| − | RFLPs were observed for the orfB gene (Figure 2A) in the mitochondrial genome between the sterile and the fertile lines. All restriction enzymes with the exception of EcoRI gave rise to a single hybridizing band with size variation between the sterile and fertile lines. Due to the presence of an EcoRI site in the orfB gene probe, digestion with EcoRI consistently generated two bands in all rice lines. The length of one band varied between the sterile and the fertile lines. Therefore, it was evident that mitochondrial orfB gene was present as a single copy with differential organization in the sterile and fertile lines.
| |
| | | | |
| | ===Expression=== | | ===Expression=== |
| | Please input expression information here. | | Please input expression information here. |
| − | Editing of the orfB transcripts
| + | |
| − | (a) The fertile line
| + | ===Evolution=== |
| − | Mitochondrial RNA editing of the orfB transcript was
| |
| − | assessed in the fertile rice line. Fourteen cDNA clones
| |
| − | obtained from cDNA library of fertile rice line were
| |
| − | sequenced. Determination of the orfB cDNA sequence
| |
| − | from overlapping clones from the cDNA library showed
| |
| − | four C®T conversions within the coding region relative
| |
| − | to the orfB genomic sequence.
| |
| − | === Evolution === | |
| − | === Knowledge Extension ===
| |
| | Please input evolution information here. | | Please input evolution information here. |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| − | orfB transcripts of the sterile line have identical 3’ ends
| |
| − | with that of transcripts from the fertile lines
| |
| − | The basis of the observed differences in the orfB gene
| |
| − | transcripts between the sterile and fertile lines was
| |
| − | determined using 3’ RACE. The forward primer OGSP1
| |
| − | (Figure 4) annealed 180 bp downstream of the
| |
| − | initiation codon in the coding region of the orfB gene.
| |
| − | In both the fertile and sterile rice lines, one amplified
| |
| − | band of ~400 bp was obtained
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| Line 40: |
Line 18: |
| | ==References== | | ==References== |
| | Please input cited references here. | | Please input cited references here. |
| − | 1. Eckardt NA: Cytoplasmic male sterility and fertility restoration. Plant Cell
| |
| − | 2006, 18:515-517.
| |
| − | 2. Hanson MR: Plant mitochondrial mutation and male sterility. Annu Rev
| |
| − | Genet 1991, 25:461-486.
| |
| − | 3. Hanson MR, Bentolila S: Interactions of mitochondrial and nuclear genes
| |
| − | that affect male gametophyte development. Plant Cell 2004, 16:154-169.
| |
| − | 4. Schnable PS, Wise RP: The molecular basis of cytoplasmic male sterility
| |
| − | and fertility restoration. Trends Plant Sci 1998, 3:175-180.
| |
| − | 5. Chase CD, Babay-Laughnan S: Cytoplasmic male sterility and fertility
| |
| − | restoration by nuclear genes. Molecular Biology and Biotechnology of Plant
| |
| − | Organelles Springer-VerlagDaniell H, Chase CD 2004, 593-622.
| |
| − | 6. Gutierres S, Combettes B, De Paepe R: In the Nicotiana sylvestris CMSII
| |
| − | mutant, a recombination-mediated change 5’ to the first exon of the
| |
| − | mitochondrial nad1 gene is associated with lack of the NADH:
| |
| − | ubiquinone oxidoreductase (complex I) NADI subunit. Eur J Biochem
| |
| − | 1999, 216:361-370.
| |
| − | 7. Unseld M, Marienfeld JR, Brandt P, Brennicke A: The mitochondrial
| |
| − | genome of Arabidopsis thaliana contains 57 genes in 366,924
| |
| − | nucleotides. Nature Genet 1997, 15:57-61.
| |
| − | {{Mitochondrion|
| |
| − | GeneName = orfB|
| |
| − | Description = ORFB protein|
| |
| − | Version = GeneID:6450152|
| |
| − | Length = 468 bp|
| |
| − | Definition = Oryza sativa Japonica Group ''orfB'', Mitochondrion gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| + | ==Structured Information== |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Mitochondrion]] |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
| |
| − | AP = Mitochondrion:53424..53891|
| |
| − | CDS = 53424..53891|
| |
| − | GCID = <gbrowseImage3>
| |
| − | name=NC_011033:53424..53891
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage3>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_011033:53424..53891
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | AA = <aaseq>MPQLDKLTYFSQFFWLCLFFFSFYILLLNNNNGILGISRILKLRNQLLSHRGNKIRFKDPKNLEDILRKGFSTGLSYMYSSLSEVSQWCKTVDYLGKRRKITLISDFGEISGSRGMERQILYLISKSSYNTSSSRITCWKKIMLTHVLHGQGSII</aaseq>|
| |
| − | DNA = <dnaseqindica>1..468#atgcctcaacttgataaattgacttatttctcacaattcttctggttatgccttttcctctttagtttttatattctcttattaaataataataatggaatacttggaattagcagaattctcaaactacggaaccaactgctttcgcaccgggggaacaagatccgtttcaaggaccctaagaatttggaagatatctcgagaaaaggttttagcaccggtctctcatatatgtactccagtttatccgaagtatcccaatggtgtaagaccgtcgactatttgggaaaaaggaggaaaatcactctgatctcagatttcggagaaataagtggctcacgaggaatggagagacagattctctatttgatctcgaagtcctcatataacacttcttccagtcggatcacttgttggaaaaaaataatgctcacacatgttccacacgggcaaggaagcataatctaa</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/gene?term=6450152 NCBI Gene:orfB]
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Mitochondrion]]
| |
| − | [[Category:Mitochondrion]]
| |
