|
|
| (16 intermediate revisions by one other user not shown) |
| Line 3: |
Line 3: |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | Calcium-dependent protein kinases (CDPKs) are crucial calcium sensors involved in plant responses to pathogen infection. The expression of OsCPK10 was strongly induced following treatment with a Magnaporthe grisea elicitor. Kinase activity assay showed that the functional OsCPK10 protein not only autophosphorylated, but also phosphorylated Casein in a calcium-dependent manner. Overexpression of constitutively active OsCPK10 in Arabidopsis enhanced the resistance to infection with Pseudomonas syringae pv. tomato, associated with elevated expression of both SA- and JA-related defense genes. Similarly, transgenic rice plants containing constitutively active OsCPK10 exhibited enhanced resistance to blast fungus M. grisea. Collectively, rice OsCPK10 is a crucial regulator in plant immune responses, and that it may regulate disease resistance by activating both SA- and JA-dependent defense responses.[1] | + | OsCPK10 is a member of OsCPKs family including 29 CPKs in rice[1]. Calcium-dependent protein kinases (CDPKs) are improtant calcium sensors icluded in plant responses to pathogen infection. The expression of OsCPK10 was strongly induced following treatment with a Magnaporthe grisea elicitor. Kinase activity assay showed that the functional OsCPK10 protein not only autophosphorylated, but also phosphorylated Casein in a calcium-dependent manner. Overexpression of constitutively active OsCPK10 in Arabidopsis enhanced the resistance to infection with Pseudomonas syringae pv. tomato, associated with elevated expression of both SA- and JA-related defense genes. Similarly, transgenic rice plants containing constitutively active OsCPK10 exhibited enhanced resistance to blast fungus M. grisea. Collectively, rice OsCPK10 is a crucial regulator in plant immune responses, and its overexpression may regulate disease resistance by activating both SA- and JA-dependent defense responses[2]. |
| | + | |
| | + | ===Protein Structure=== |
| | + | OsCPK10 has a variable domain (residues 1-132), a kinase domain (residues 133-396), a junction domain (residues 397-427) and a Calmodulin-like domain (residues 428-599). Four EF-hands were found in the Calmodulin-like domain (residues 438-466, 474-502, 510-538, and 544-572)[2]. |
| | + | |
| | + | |
| | + | [[File:structure.jpg]] |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | The expression of OsCPK10, in M.grisea elicitor-treated rice calli, shows a rapid activation and peaks at 1 hour, which is earlier than that of OsPAL1 expression. This result indicates that OsCPK10 is an early pathogen-responsive gene[2]. |
| | + | |
| | + | |
| | + | [[File:Os03g0788500expression.jpg]][[File:expression2.jpg]] |
| | + | |
| | + | ===Isolation and sequence analysis=== |
| | + | OsCPK10 is isolated by PT-PCR from the total RNA extraction using specific primer pairs and the coding region of OsCPK10 is 1800 bp in length which encodes 599 amino acids. (Primers:forward 5'-ATGGGGAACACGTGCGTC-3' and reverse 5'-TCAAGACATCCTCAAGGCCTC-3'). The PCR products were ligated to a pEASY-T1 vector (TransGen Biotech, China)[2]. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| Line 14: |
Line 26: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | State Key Laboratory of Protein and Plant Gene Research, College of Life Sciences, Peking University, Beijing 100871, China |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | [1] B. Wan, Y. Lin, T. Mou, Expression of rice Ca2+-dependent protein kinases (CDPKs) genes under different environmental stresses, FEBS Lett. 581 (2007)1179e1189 |
| | + | [2] Fu L, Yu X, An C. Overexpression of constitutively active OsCPK10 increases Arabidopsis resistance against Pseudomonas syringae pv. tomato and rice resistance against Magnaporthe grisea. Plant Physiol Biochem. 2013 Dec;73:202-10. doi: 10.1016/j.plaphy.2013.10.004. Epub 2013 Oct 11. PubMed PMID: 24141028. |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os03g0788500|
| |
| − | Description = Similar to Calcium-dependent protein kinase 2|
| |
| − | Version = NM_001058038.1 GI:115455804 GeneID:4334366|
| |
| − | Length = 3830 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0788500, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:33602511..33606340|
| |
| − | CDS = 33603134..33603995,33604439..33604582,33604704..33604856,33604980..33605095,33605363..33605530<br>,33605643..33605867,33605993..33606124|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:33602511..33606340
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:33602511..33606340
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggggaacacgtgcgtcggccccagcatcagcaagaacggcttcttccagtccgtctccacggtgctctggaaggcgcgccaggacggcgacgacgcgctgcccggcgccaatggcgcccctgacggcggcggccagggccggttgccggcgccgccgccgccgacttccgacgcgccgctcgccgtccaaaacaagccccccgagcacgtcaagatcgtctcgaccacggacaccgcctccgccgagcaggacgcctccaagtcgagcgccggctcggactccggcgaggccgccaggccgcggccgagggtgccgccggtgaagcgcgtctccagcgccgggctgctcgtcggctcggtgctgaagcgcaagacggagagtctcaaggacaagtacagcctggggcggaagctcgggcaggggcagttcgggacgacgtacctgtgcgtggagcgcgccaccggcaaggagttcgcctgcaagtccatcctgaagcggaagctggtcaccgacgacgacgtcgaggacgtccgccgcgagatccagataatgtaccacctcgccggccaccccaacgtgatctccatcaggggcgcctacgaggacgccgtcgccgtgcacctcgtcatggagctctgcgccggcggcgagctgttcgaccggatcgtccagaaggggcactacaccgagcggaaggcggcggagctcgccagggtcatcgtcggcgtcgtcgaggtgtgccactccatgggcgtgatgcaccgtgatctcaagcccgagaacttcctcttcgccgaccagacggaggaggccgctctcaagaccattgactttggtctctccattttctttcgcccaggtcaagtattcactgatgttgttggtagcccttactatgtcgcgccagaagttctgaaaaagaaatatggtcaagaggcagatgtctggagcgctggtgtgataatttacatcttgttgtgtggtgtgccgccattttgggcagagaacgagcagggtatatttgaagaggttttgcatggtagacttgactttcagtcagaaccatggcctagcatctctgaaggtgccaaagatctcgtaaggagaatgcttgttagggacccgaagaagagattgacagctcatgaagttttaaggcatccatgggtccaggttggtggtttggctcctgacaagcccctggattctgctgttctatctcgtatgaagcaattctcagctatgaataagctgaaaaagatggctcttagggtcattgcagagaacctatctgaagacgaaatcgccggcctgaaagaaatgttcaagatgatcgacacagacaacagtggacagatcaccttcgaagaactcaaggttggtctgaaaaaagtcggtgctaacctccaagaatccgagatctacgcactcatgcaagccgcagatgtagataacagcggcacgatagattacggtgagttcatcgctgcaactctgcatatgaacaagatcgagcgggaggatcacctgttcgcggcgttccaatacttcgacaaggacggcagcggctacatcacggccgatgagctgcagctcgcctgcgaggagttcggcttgggagacgttcagctcgaggagatgatcagagaagtcgacgaagacaacgatggtcgcatagattacaacgagttcgtggcgatgatgcagaagccgacgatggggctcccggcgaagaagtccggcgggctgcagaacagtttcagcatcggcttcagggaggccttgaggatgtcttga</cdnaseq>|
| |
| − | AA = <aaseq>MGNTCVGPSISKNGFFQSVSTVLWKARQDGDDALPGANGAPDGG GQGRLPAPPPPTSDAPLAVQNKPPEHVKIVSTTDTASAEQDASKSSAGSDSGEAARPR PRVPPVKRVSSAGLLVGSVLKRKTESLKDKYSLGRKLGQGQFGTTYLCVERATGKEFA CKSILKRKLVTDDDVEDVRREIQIMYHLAGHPNVISIRGAYEDAVAVHLVMELCAGGE LFDRIVQKGHYTERKAAELARVIVGVVEVCHSMGVMHRDLKPENFLFADQTEEAALKT IDFGLSIFFRPGQVFTDVVGSPYYVAPEVLKKKYGQEADVWSAGVIIYILLCGVPPFW AENEQGIFEEVLHGRLDFQSEPWPSISEGAKDLVRRMLVRDPKKRLTAHEVLRHPWVQ VGGLAPDKPLDSAVLSRMKQFSAMNKLKKMALRVIAENLSEDEIAGLKEMFKMIDTDN SGQITFEELKVGLKKVGANLQESEIYALMQAADVDNSGTIDYGEFIAATLHMNKIERE DHLFAAFQYFDKDGSGYITADELQLACEEFGLGDVQLEEMIREVDEDNDGRIDYNEFV AMMQKPTMGLPAKKSGGLQNSFSIGFREALRMS</aaseq>|
| |
| − | DNA = <dnaseqindica>624..1485#1929..2072#2194..2346#2470..2585#2853..3020#3133..3357#3483..3614#aggtgtcacaggtttcttctcctcttatccttcctttccatcggttcttgtacttggtggtatacccctagctgctcgcctttgtgttaatttggttggattgggagtttcttgttctctctttagccttgagcgatcttggtttcttgcaattagcctttgactgcttcttcttcttccacttgccgccggcagctagaagtggtccatcgtaccaaccctttcgtcctcattgaaccattccgcctcgctcccagctccattactagaagcactagagctagcgtgaatgcgtgatccttgatgcgtagttagcagctagctcctgcccccaatctgccatctccgcattgcgattttgagtttttgagattgtaatttgcgaacgatctcggttgtgctgagagcttagcgttgacttcgatgggtgcatcgcgttcgatcgccgattctgatttggtcgcgtgatccgggggtgatcggtgattactccgagcgggaggggagatcgtctcttggcgcggttgcgcttcgccgcgcggagggagagacattcgcggcgtaatccgaaggtgtttgttggatcgaggcgtggtgtccgagaaagattcggagcggcggcaatggggaacacgtgcgtcggccccagcatcagcaagaacggcttcttccagtccgtctccacggtgctctggaaggcgcgccaggacggcgacgacgcgctgcccggcgccaatggcgcccctgacggcggcggccagggccggttgccggcgccgccgccgccgacttccgacgcgccgctcgccgtccaaaacaagccccccgagcacgtcaagatcgtctcgaccacggacaccgcctccgccgagcaggacgcctccaagtcgagcgccggctcggactccggcgaggccgccaggccgcggccgagggtgccgccggtgaagcgcgtctccagcgccgggctgctcgtcggctcggtgctgaagcgcaagacggagagtctcaaggacaagtacagcctggggcggaagctcgggcaggggcagttcgggacgacgtacctgtgcgtggagcgcgccaccggcaaggagttcgcctgcaagtccatcctgaagcggaagctggtcaccgacgacgacgtcgaggacgtccgccgcgagatccagataatgtaccacctcgccggccaccccaacgtgatctccatcaggggcgcctacgaggacgccgtcgccgtgcacctcgtcatggagctctgcgccggcggcgagctgttcgaccggatcgtccagaaggggcactacaccgagcggaaggcggcggagctcgccagggtcatcgtcggcgtcgtcgaggtgtgccactccatgggcgtgatgcaccgtgatctcaagcccgagaacttcctcttcgccgaccagacggaggaggccgctctcaagaccattgactttggtctctccattttctttcgcccaggtgagcgaatcacattttcttttccttttttcttttccagaatggcgcattgaatttagtatctataactgttataacaaacaagatttccaatccattcaagaaatcacactgcatctatggataagtagagaatgaatatggcctaatctttcatgtactgatttgatctttagtgaatctgaagttcttgagtttcagcatttgtttttgggacaactgcattattgtgcttatgatagtactaatactgctgtgagattttatgcttcagaacttaatttcctttacctacatttcaaagttttcaacaccatttgtttctgcataagttctgcaaaaagtttggctgcatatctttaccattctgcagtctgctaccatatcattcagatgaattcattctccattgggtttctactcatatgccattcttattccaggtcaagtattcactgatgttgttggtagcccttactatgtcgcgccagaagttctgaaaaagaaatatggtcaagaggcagatgtctggagcgctggtgtgataatttacatcttgttgtgtggtgtgccgccattttgggcaggtaagaattttgctgatttttcagtcaatcacaaaacaattatactaactttcgtgacaaaatgtgatgtattttgatccgaactcttgtactaattaagctctccattgttgtgaatcagagaacgagcagggtatatttgaagaggttttgcatggtagacttgactttcagtcagaaccatggcctagcatctctgaaggtgccaaagatctcgtaaggagaatgcttgttagggacccgaagaagagattgacagctcatgaagttttaagtaagttacttgattaattttcatgatatattcctaaatgtatttttctagctattttagtagtgcagggctgcaggccatgaacagtgcagtctgatttacttggcattatcatcttttcagggcatccatgggtccaggttggtggtttggctcctgacaagcccctggattctgctgttctatctcgtatgaagcaattctcagctatgaataagctgaaaaagatggctcttagggtaagtatgacttggacacaaattgttactatatttctgatttctctatgaaatattttcccaatattaggatagcaccatcttgtcgttggccttttgtcctcatgcaccaaaggaaaatctgtttggagtttagctcatgcaagatacagtacataatcattttaaaaaataagtatccaatgttgtattagttggagaatgttgttcatcttgaatggttcaatcatacttacctgcatgtcctgatacctttgttgattccaggtcattgcagagaacctatctgaagacgaaatcgccggcctgaaagaaatgttcaagatgatcgacacagacaacagtggacagatcaccttcgaagaactcaaggttggtctgaaaaaagtcggtgctaacctccaagaatccgagatctacgcactcatgcaagccgtaagttcttaagcaatctaccaattccgtcgagtacttttacggtggtctctactggtcgaaaacatcaaaattgcatttgtatctgaattctgaaatggtattattacaggcagatgtagataacagcggcacgatagattacggtgagttcatcgctgcaactctgcatatgaacaagatcgagcgggaggatcacctgttcgcggcgttccaatacttcgacaaggacggcagcggctacatcacggccgatgagctgcagctcgcctgcgaggagttcggcttgggagacgttcagctcgaggagatgatcagagaagtcgacgaagacaacgtcagtaaaaaaaaaaaagaacctacttttccattccattctgatcgaagctagctaatcacattgcctgaaatgcttgatctgacggaactttcgctgttctttttcgtgccttgtgtttgcaggatggtcgcatagattacaacgagttcgtggcgatgatgcagaagccgacgatggggctcccggcgaagaagtccggcgggctgcagaacagtttcagcatcggcttcagggaggccttgaggatgtcttgagaaacagccactagagtcagtcacacacttgtagaggcgacgacaacgagatcgatatgttgtcttccatagggctggtaatttcgaaacggggaaaaaaatggctggaggagatgtgcgtgtacgtacaggcgtagaggggggtgggtcactcttgggtcattggttcgattgttttcttctgacgttaaaaatacaagagaggtttttcgttcc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001058038.1 RefSeq:Os03g0788500]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
OsCPK10 is a member of OsCPKs family including 29 CPKs in rice[1]. Calcium-dependent protein kinases (CDPKs) are improtant calcium sensors icluded in plant responses to pathogen infection. The expression of OsCPK10 was strongly induced following treatment with a Magnaporthe grisea elicitor. Kinase activity assay showed that the functional OsCPK10 protein not only autophosphorylated, but also phosphorylated Casein in a calcium-dependent manner. Overexpression of constitutively active OsCPK10 in Arabidopsis enhanced the resistance to infection with Pseudomonas syringae pv. tomato, associated with elevated expression of both SA- and JA-related defense genes. Similarly, transgenic rice plants containing constitutively active OsCPK10 exhibited enhanced resistance to blast fungus M. grisea. Collectively, rice OsCPK10 is a crucial regulator in plant immune responses, and its overexpression may regulate disease resistance by activating both SA- and JA-dependent defense responses[2].
Protein Structure
OsCPK10 has a variable domain (residues 1-132), a kinase domain (residues 133-396), a junction domain (residues 397-427) and a Calmodulin-like domain (residues 428-599). Four EF-hands were found in the Calmodulin-like domain (residues 438-466, 474-502, 510-538, and 544-572)[2].
Expression
The expression of OsCPK10, in M.grisea elicitor-treated rice calli, shows a rapid activation and peaks at 1 hour, which is earlier than that of OsPAL1 expression. This result indicates that OsCPK10 is an early pathogen-responsive gene[2].

Isolation and sequence analysis
OsCPK10 is isolated by PT-PCR from the total RNA extraction using specific primer pairs and the coding region of OsCPK10 is 1800 bp in length which encodes 599 amino acids. (Primers:forward 5'-ATGGGGAACACGTGCGTC-3' and reverse 5'-TCAAGACATCCTCAAGGCCTC-3'). The PCR products were ligated to a pEASY-T1 vector (TransGen Biotech, China)[2].
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
State Key Laboratory of Protein and Plant Gene Research, College of Life Sciences, Peking University, Beijing 100871, China
References
[1] B. Wan, Y. Lin, T. Mou, Expression of rice Ca2+-dependent protein kinases (CDPKs) genes under different environmental stresses, FEBS Lett. 581 (2007)1179e1189
[2] Fu L, Yu X, An C. Overexpression of constitutively active OsCPK10 increases Arabidopsis resistance against Pseudomonas syringae pv. tomato and rice resistance against Magnaporthe grisea. Plant Physiol Biochem. 2013 Dec;73:202-10. doi: 10.1016/j.plaphy.2013.10.004. Epub 2013 Oct 11. PubMed PMID: 24141028.
Structured Information