Difference between revisions of "Os10g0148000"

From RiceWiki
Jump to: navigation, search
(References)
(Structured Information)
Line 24: Line 24:
 
</references>
 
</references>
  
==Structured Information==
 
{{JaponicaGene|
 
GeneName = Os10g0148000|
 
Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|
 
Version = NM_001070697.2 GI:297610101 GeneID:4348109|
 
Length = 1111 bp|
 
Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
 
AP = Chromosome 10:2864478..2865588|
 
CDS = 2864524..2864871|
 
GCID = <gbrowseImage1>
 
name=NC_008403:2864478..2865588
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008403:2864478..2865588
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga</cdnaseq>|
 
AA = <aaseq>MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK                    FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG                    NCGGEQASLDWPH</aaseq>|
 
DNA = <dnaseqindica>47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Revision as of 03:27, 12 June 2015

OsDIL is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP.

Annotated Information

Function

OsDIL (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages[1].

Expression

OsDIL (Os10g0148000) encoding a lipid transfer protein. OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family . To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene.

Fig1

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.

References

  1. Guo, C., et al. (2013). "The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages." Plant Mol Biol 82(3): 239-253 .