Difference between revisions of "Os03g0294700"

From RiceWiki
Jump to: navigation, search
(Structured Information)
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
an ETHYLENE OVERPRODUCER 1-like gene ('''''OsETOL1'''''), modulates differentially '''drought and submergence tolerance''' in rice<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
[[File: OsETOL1 Working model1.jpg|left|thumb|250px|'''Figure 1.''' ''Working model for the function of OsETOL1 in response to drought and submergence stresses.(from reference <ref name="ref1"/>).'']]
 +
*The ''OsETOL1'' transcript was differentially responsive to abiotic stresses. ''OsETOL1'' was found to '''interact with ''OsACS2''''', a homolog of 1-amino-cyclopropane-1-carboxylate (ACC) synthase (ACS), which acts as a '''rate-limiting enzyme for ethylene biosynthesis'''<ref name="ref1"/>.
 +
 
 +
*''OsETOL1'' plays distinct roles in '''drought and submergence tolerance''' by '''modulating ethylene production''' and '''energy metabolism'''. Findings from the expression and functional comparison of three ethylene overproducer (ETOL) family members in rice further supported the specific role of ''OsETOL1'' in the responses to the two water stresses<ref name="ref1"/>.
 +
 
 +
*''OsETOL1'' gene may have a '''negative role''' in drought tolerance at the '''reproductive stage'''. It plays a negative role in ethylene biosynthesis. In a yeast two-hybrid assay, OsETOL1 interacted with ''OsACS2''. The interaction between ''OsETOL1'' and ''OsACS2'' was further confirmed by a bimolecular fluorescence complementation (BiFC) assay in ''Arabidopsis'' protoplasts, which indicating that ''OsETOL1'' may '''function in ACC biosynthesis''' by interacting with ''OsACS2'' in rice<ref name="ref1"/>.
 +
 
 +
*''Du et al.'' propose a '''simplified model''' for the distinct roles of ''OsETOL1'' in drought and submergence tolerance (Figure 1)<ref name="ref1"/>:
 +
**Under drought stress at the reproductive stage, the function of ''OsETOL1'' may inhibit the transportation of carbohydrates from leaves to the developing seeds and result in a reduction in grain-filling and spikelet fertility and a delay in ethyleneinduced maturation.
 +
**Under submergence conditions, however, carbohydrate consumption and energy production was promoted by ''OsETOL1'', this change enabled the upper leaves to elongate to extend above the surface of the water.
 +
**The same function of ''OsETOL1'' in modulation of ethylene production caused different morphological alterations in rice under drought and submergence conditions. The ''OsETOL1''-mediated ethylene production and energy metabolism may provide an access to reveal the adaptation strategy to drought and submergence stresses in plants.
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0005488 GO:0005488]   
 +
 
 +
===Mutation===
 +
Mutants and OE plants<ref name="ref1"/>:
 +
*''osetol1-2'' also showed the drought-resistant phenotype. The T-DNA insertion sites of the ''osetol1-1'' and ''osetol1-2'' mutants were located in the '''third intron''' and the '''first exon''', respectively.
 +
 
 +
*Transcript analysis of ''OsETOL1'' suggested that the expression of ''OsETOL1'' was abolished in both the osetol1-1 and osetol1-2 mutants.
 +
 
 +
*Two allelic mutants of ''OsETOL1'' showed '''increased resistance''' to '''drought stress''' at the '''panicle development stage'''. Interestingly, the mutants exhibited a significantly '''slower growth rate''' under '''submergence stress''' at both the '''seedling and panicle development stages'''.
 +
 
 +
*Over-expression (OE) of ''OsETOL1'' in rice resulted in '''reverse phenotypes''' when compared with the mutants.
 +
 
 +
*In the ''osacs2'' mutant and ''OsETOL1''-OE plants, '''ACC''' and '''ethylene content''' were '''decreased''' significantly, and exogenous ACC restored the phenotype of ''osetol1'' and ''OsETOL1''-OE to wild-type under submergence stress, implying a '''negative''' role for OsETOL1 in ethylene biosynthesis.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*The expression of '''several genes''' related to '''carbohydrate catabolism''' and '''fermentation''' showed significant changes in the ''osetol1'' and OsETOL1-OE plants, implying that ''OsETOL1'' may affect energy metabolism<ref name="ref1"/>.
 +
 
 +
*Co-segregation analysis suggested that the drought resistance phenotype was '''due to''' the '''T-DNA insertion''' in the ''OsETOL1'' gene. The positive effect of OsETOL1-OE on plant growth under submergence conditions '''may''' be '''partially due to''' the '''relatively high level''' of '''soluble sugar''' for energy metabolism. In addition, the '''positive role''' of ''OsETOL1'' in submergence tolerance may be independent of ''SNORKEL1/2'' and 'SUB1A'' as these genes are absent in the rice ZH11<ref name="ref1"/>.
 +
 
 +
*The ''OsETOL1'' transcript level was '''strongly induced''' by '''drought''' and '''ABA''', and it was also '''slightly induced''' by '''salt''', '''heat''', and '''ethylene''' treatments. During '''submergence treatment''', the ''OsETOL1'' transcript was '''rapidly induced''' to about seven-fold at 12 h after the initiation of stress, but after this time point the expression '''declined slowly''' to the level seen under normal conditions, and it was '''suppressed''' after submergence for 5 days<ref name="ref1"/>.
 +
 
 +
*The '''GUS signal''' in the transgenic rice was '''strong in''' the '''anther''', '''spikelet hull''', '''node''', '''old root''', '''sheaths''', and '''mature leaves''' by comparison, but the signal was '''weak in callus''', '''young bud''', '''root''', and '''immature endosperm''', a finding that agreed well with the results from the microarray and qPCR<ref name="ref1"/>.
 +
 
 +
===Subcellular localization===
 +
Green fluorescence produced by ''OsETOL1''-EGFP overlapped with red fluorescence (RFP) produced by 35S: AtAOS–ERFP, suggesting that ''OsETOL1'' is a '''cytosolic protein'''<ref name="ref1"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
''OsETOL1'' is a '''homolog of''' the ''Arabidopsis'' ''ETO1'' protein that participates in the degradation of type-2 ACS, a ratelimiting enzyme of ethylene biosynthesis<ref name="ref2"/>. '''Two''' additional '''ETO homologs''', ''OsETOL2'' (LOC_Os07g08120) and ''OsETOL3'' (LOC_Os11g37520) showing '''73''' and '''78% identity''', respectively, to ''OsETOL1''<ref name="ref1"/>.
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Du H, Wu N, Cui F, et al. A homolog of ETHYLENE OVERPRODUCER, OsETOL1, differentially modulates drought and submergence tolerance in rice[J]. The Plant Journal, 2014, 78(5): 834-849.
 +
</ref>
 +
* <ref name="ref2">
 +
Wang K L C, Yoshida H, Lurin C, et al. Regulation of ethylene gas biosynthesis by the Arabidopsis ETO1 protein[J]. Nature, 2004, 428(6986): 945-950.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os03g0294700|
 
Description = Similar to Ethylene-overproduction protein 1|
 
Version = NM_001056354.1 GI:115452436 GeneID:4332527|
 
Length = 3630 bp|
 
Definition = Oryza sativa Japonica Group Os03g0294700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:10338564..10342193|
 
CDS = 10338564..10339517,10340008..10340301,10340379..10340688,10341438..10341667|
 
GCID = <gbrowseImage1>
 
name=NC_008396:10338564..10342193
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:10338564..10342193
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>gaagccgcccacctcctcgtcgccgcctgcctccaggccttcctccgggagctccccaagtcgctctccaaccccgacgtcgcgcgcctgctctgcagcccagatggcagggagcgcctcgacatcgccgggaacgcgtcgttcgcgctctactacttcctctcgtccgttgccatggaggaggacatcaggtcgaacaccacggtgatgctgctggagaggctatgtgaatctgcggagcgaccatggcagaagcagctggcattgcaccaattcgggtgtgtgatgctggagcggggtgaattcaaggacgcgcaggggtggttcgaggatgccattgccgagggccacacgtactcgctcgccggcgtggcgcgctccaagttcaagcgtggccacaagtactcggcatacaagatgatgaacagcatcatggaggactacgagccggccgggtggatgtaccaagaacgttcactgtactgtgttgggaaggagaagatggctgatctccatatagcaacagagctcgacccaaccctgacattcccatacaagtaccgtgccgttgtgttcttagaggaggacatggttgagtctgctgtcgcagagatcagcaaggtccttggattcaagctggtgactgactgccttgagctccgggcatggttctaccttgcacttgaggagtatgaggctgcagtgcgggatatcagggcgatattgacgttggatcctagttacatgatgtttcatggaaaagtgcatggagaacagctgatcgagatcctccgagggtatgtgcagcaatgggatatggcggattgctggatgcagctctatgaccggtggtcagaggtggatgacatcggctctctggctgtcgttcagcagatgctcaccagggaacctgggaacagtagcttgcggttccgacaatcactgctcctattaagactaaattgtcaaaaggctgcgatgcgtagtttgagatttgcacgaaattgttcggctcatgagcatgagagacttgtatacgaaggatggattttgtacgatactggacaccgtgatgaagcacttgccaaggctgaacaatcgattaaaatccaaagatcatttgaagccttttttctgaaggcatatgctctaggggattccagccttgacacagaatcttcactctctgttgttcaacttctagaacatgctaatagttgtgcatctgacaatcttcgcaagggacaagcatataacaatatggggagcatatatgtggattgtgatttgctagatgaggcagctgaatgttacaacatagcattgaatataaagcatacacgggcgcatcagggtctggcacgggtccattacctgaaaaataggaaaaaggctgcgtatggagagatgtctgaactaataaaggtagctaaagacagtgcatcggcatatgaaaaacggtcggaatatggtgaaagagatgaagcaagaagtgatctcaatatggcaacacttttggatcctacaaggacttacccttacagatacagagcagctgttctgatggacgaaagcaaggaagacgaggcgatcggagagctctcacaagcaatagctttcagggcagacctccagctgctccatctccgggcagcattcttcgactccatgggcgacaacgccaacaccctgcgggactgcgaggctgccctttgcctggacccgacacacggtgacaccctggagctgtacagaaaagcttctacaaaagccgaaccacaaagctag</cdnaseq>|
 
AA = <aaseq>EAAHLLVAACLQAFLRELPKSLSNPDVARLLCSPDGRERLDIAG                    NASFALYYFLSSVAMEEDIRSNTTVMLLERLCESAERPWQKQLALHQFGCVMLERGEF                    KDAQGWFEDAIAEGHTYSLAGVARSKFKRGHKYSAYKMMNSIMEDYEPAGWMYQERSL                    YCVGKEKMADLHIATELDPTLTFPYKYRAVVFLEEDMVESAVAEISKVLGFKLVTDCL                    ELRAWFYLALEEYEAAVRDIRAILTLDPSYMMFHGKVHGEQLIEILRGYVQQWDMADC                    WMQLYDRWSEVDDIGSLAVVQQMLTREPGNSSLRFRQSLLLLRLNCQKAAMRSLRFAR                    NCSAHEHERLVYEGWILYDTGHRDEALAKAEQSIKIQRSFEAFFLKAYALGDSSLDTE                    SSLSVVQLLEHANSCASDNLRKGQAYNNMGSIYVDCDLLDEAAECYNIALNIKHTRAH                    QGLARVHYLKNRKKAAYGEMSELIKVAKDSASAYEKRSEYGERDEARSDLNMATLLDP                    TRTYPYRYRAAVLMDESKEDEAIGELSQAIAFRADLQLLHLRAAFFDSMGDNANTLRD                    CEAALCLDPTHGDTLELYRKASTKAEPQS</aaseq>|
 
DNA = <dnaseqindica>1..954#1445..1738#1816..2125#2875..3104#gaagccgcccacctcctcgtcgccgcctgcctccaggccttcctccgggagctccccaagtcgctctccaaccccgacgtcgcgcgcctgctctgcagcccagatggcagggagcgcctcgacatcgccgggaacgcgtcgttcgcgctctactacttcctctcgtccgttgccatggaggaggacatcaggtcgaacaccacggtgatgctgctggagaggctatgtgaatctgcggagcgaccatggcagaagcagctggcattgcaccaattcgggtgtgtgatgctggagcggggtgaattcaaggacgcgcaggggtggttcgaggatgccattgccgagggccacacgtactcgctcgccggcgtggcgcgctccaagttcaagcgtggccacaagtactcggcatacaagatgatgaacagcatcatggaggactacgagccggccgggtggatgtaccaagaacgttcactgtactgtgttgggaaggagaagatggctgatctccatatagcaacagagctcgacccaaccctgacattcccatacaagtaccgtgccgttgtgttcttagaggaggacatggttgagtctgctgtcgcagagatcagcaaggtccttggattcaagctggtgactgactgccttgagctccgggcatggttctaccttgcacttgaggagtatgaggctgcagtgcgggatatcagggcgatattgacgttggatcctagttacatgatgtttcatggaaaagtgcatggagaacagctgatcgagatcctccgagggtatgtgcagcaatgggatatggcggattgctggatgcagctctatgaccggtggtcagaggtggatgacatcggctctctggctgtcgttcagcagatgctcaccagggaacctgggaacagtagcttgcggttccgacaatcactgctcctattaaggcatgtaccttttctctcttttcatttgacaatggatcccattttctaaaaaaattgtcgagactaatcccaccaactgaatcgtaagtttgatattttcattagctataaaaaaaagtagaattgattgaacagctctttgtgtgcttccttttgtctgataattttgtgggtcaatttaactagctgatcattgcctatgctttcttttacatataggagtgcaagctttattaaaattggaaccaaatttacaaaaatgaaaataatttgtaagattgttggtgtgaaggctcatggacattagtaagttatgctctaagctatgtttccgtgcgtgtacagatttttttttgtgataacataaaaaaaaagtgggggatcgaagattattatttgataacaaaaggagagaaccaaaatgatactactaatttgtagtttgttttgttcatgggcttaatatttttttctttctcgttcattgtagactaaattgtcaaaaggctgcgatgcgtagtttgagatttgcacgaaattgttcggctcatgagcatgagagacttgtatacgaaggatggattttgtacgatactggacaccgtgatgaagcacttgccaaggctgaacaatcgattaaaatccaaagatcatttgaagccttttttctgaaggcatatgctctaggggattccagccttgacacagaatcttcactctctgttgttcaacttctagaacatgctaatagttgtgcatctgacaatcttcgcaagggacaagtaagaactattcattgtctctcatttgcatgatgatatcgattgattatttgctctaacaaccatacatttttcaggcatataacaatatggggagcatatatgtggattgtgatttgctagatgaggcagctgaatgttacaacatagcattgaatataaagcatacacgggcgcatcagggtctggcacgggtccattacctgaaaaataggaaaaaggctgcgtatggagagatgtctgaactaataaaggtagctaaagacagtgcatcggcatatgaaaaacggtcggaatatggtgaaagagatgaagcaagaagtgatctcaatatggcaacacttttggatcctacaaggacttacccttacagatacagagcagctggtaagtgcgcttaaacatattttgtggacttctttcattgttttgatgtctatgctatggttgcagtcgctttgacttagtaacaccaaatctcatggatttgtagaaggcttgcattctgtttagatttgcatgataagattactacccattgatttgtgtcagaagatttgcggagacatagctggtcattatatttcagtggctcataacggttttcgtttggatcttgtagtacttctcatttacagtctagtattctctatgaccacagctctacattgatgttatatcttccaatcccactacacagtttttccgagttgcattttgacgaatataaatgatctttaatactcctagcatttatactacctccgttttaggttataagactttctagtattgctcatattcatatagatgttaatgaatctaggcacacatatatgtctagattcattaatatatatatgaatgtggacaatgctagaaagtcctataatatgaaacggaggaagtaccatttaaaatgtaagtaagatattagctggtacagaagttacagtttatacttaccaaaagaatttcatgccctgttacaggaacggctagtgatgtagtgcatgccattgctaccttcttcagtttgcatttttgatttaagaatgcgcaagttgacaactagtattatagcactgtggagcacaatactatactaccgttttcctttttgcgtgttttctcagttctgatggacgaaagcaaggaagacgaggcgatcggagagctctcacaagcaatagctttcagggcagacctccagctgctccatctccgggcagcattcttcgactccatgggcgacaacgccaacaccctgcgggactgcgaggctgccctttgcctggacccgacacacggtgacaccctggagctgtacagaaaagcttctacaaaagccgaaccacaaagctagtaaaataacctgtgcactcgccatgccacctcatcgtcgccatcttcgtcgtcgtcgattcagctgcagattttttttttctaggcaggatgatgaaacgattgttccttcgagagagctgtgaaagtaacagattaacagaagcccctgcggatcagtgaggcaggatcacgagaaggtacacagtacataacacatgattacgagtgtaagtattacagtgcttactcctactagcttggaggcaccgggaagacagagagatccacaggagatgaacatgttgtaaattatgatagcgttgtgtaaatggcaaaagaaaaaagaagatttgttatgtacatcaaagataacaaatcgctccagaagagagagctaaagaggaagcaacggtgtcctttaattagaccgggcacatacttttcccccttttcttctccccttctttaatgccttttgatctgtatttggaggcacgttttctcgttgcttaagcttttccatgatgcattcatgcaggcaaggc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056354.1 RefSeq:Os03g0294700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 05:47, 12 June 2015

an ETHYLENE OVERPRODUCER 1-like gene (OsETOL1), modulates differentially drought and submergence tolerance in rice[1].

Annotated Information

Function

Figure 1. Working model for the function of OsETOL1 in response to drought and submergence stresses.(from reference [1]).
  • The OsETOL1 transcript was differentially responsive to abiotic stresses. OsETOL1 was found to interact with OsACS2, a homolog of 1-amino-cyclopropane-1-carboxylate (ACC) synthase (ACS), which acts as a rate-limiting enzyme for ethylene biosynthesis[1].
  • OsETOL1 plays distinct roles in drought and submergence tolerance by modulating ethylene production and energy metabolism. Findings from the expression and functional comparison of three ethylene overproducer (ETOL) family members in rice further supported the specific role of OsETOL1 in the responses to the two water stresses[1].
  • OsETOL1 gene may have a negative role in drought tolerance at the reproductive stage. It plays a negative role in ethylene biosynthesis. In a yeast two-hybrid assay, OsETOL1 interacted with OsACS2. The interaction between OsETOL1 and OsACS2 was further confirmed by a bimolecular fluorescence complementation (BiFC) assay in Arabidopsis protoplasts, which indicating that OsETOL1 may function in ACC biosynthesis by interacting with OsACS2 in rice[1].
  • Du et al. propose a simplified model for the distinct roles of OsETOL1 in drought and submergence tolerance (Figure 1)[1]:
    • Under drought stress at the reproductive stage, the function of OsETOL1 may inhibit the transportation of carbohydrates from leaves to the developing seeds and result in a reduction in grain-filling and spikelet fertility and a delay in ethyleneinduced maturation.
    • Under submergence conditions, however, carbohydrate consumption and energy production was promoted by OsETOL1, this change enabled the upper leaves to elongate to extend above the surface of the water.
    • The same function of OsETOL1 in modulation of ethylene production caused different morphological alterations in rice under drought and submergence conditions. The OsETOL1-mediated ethylene production and energy metabolism may provide an access to reveal the adaptation strategy to drought and submergence stresses in plants.


GO assignment(s): GO:0005488

Mutation

Mutants and OE plants[1]:

  • osetol1-2 also showed the drought-resistant phenotype. The T-DNA insertion sites of the osetol1-1 and osetol1-2 mutants were located in the third intron and the first exon, respectively.
  • Transcript analysis of OsETOL1 suggested that the expression of OsETOL1 was abolished in both the osetol1-1 and osetol1-2 mutants.
  • Two allelic mutants of OsETOL1 showed increased resistance to drought stress at the panicle development stage. Interestingly, the mutants exhibited a significantly slower growth rate under submergence stress at both the seedling and panicle development stages.
  • Over-expression (OE) of OsETOL1 in rice resulted in reverse phenotypes when compared with the mutants.
  • In the osacs2 mutant and OsETOL1-OE plants, ACC and ethylene content were decreased significantly, and exogenous ACC restored the phenotype of osetol1 and OsETOL1-OE to wild-type under submergence stress, implying a negative role for OsETOL1 in ethylene biosynthesis.

Expression

  • The expression of several genes related to carbohydrate catabolism and fermentation showed significant changes in the osetol1 and OsETOL1-OE plants, implying that OsETOL1 may affect energy metabolism[1].
  • Co-segregation analysis suggested that the drought resistance phenotype was due to the T-DNA insertion in the OsETOL1 gene. The positive effect of OsETOL1-OE on plant growth under submergence conditions may be partially due to the relatively high level of soluble sugar for energy metabolism. In addition, the positive role of OsETOL1 in submergence tolerance may be independent of SNORKEL1/2 and 'SUB1A as these genes are absent in the rice ZH11[1].
  • The OsETOL1 transcript level was strongly induced by drought and ABA, and it was also slightly induced by salt, heat, and ethylene treatments. During submergence treatment, the OsETOL1 transcript was rapidly induced to about seven-fold at 12 h after the initiation of stress, but after this time point the expression declined slowly to the level seen under normal conditions, and it was suppressed after submergence for 5 days[1].
  • The GUS signal in the transgenic rice was strong in the anther, spikelet hull, node, old root, sheaths, and mature leaves by comparison, but the signal was weak in callus, young bud, root, and immature endosperm, a finding that agreed well with the results from the microarray and qPCR[1].

Subcellular localization

Green fluorescence produced by OsETOL1-EGFP overlapped with red fluorescence (RFP) produced by 35S: AtAOS–ERFP, suggesting that OsETOL1 is a cytosolic protein[1].

Evolution

OsETOL1 is a homolog of the Arabidopsis ETO1 protein that participates in the degradation of type-2 ACS, a ratelimiting enzyme of ethylene biosynthesis[2]. Two additional ETO homologs, OsETOL2 (LOC_Os07g08120) and OsETOL3 (LOC_Os11g37520) showing 73 and 78% identity, respectively, to OsETOL1[1].

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 Du H, Wu N, Cui F, et al. A homolog of ETHYLENE OVERPRODUCER, OsETOL1, differentially modulates drought and submergence tolerance in rice[J]. The Plant Journal, 2014, 78(5): 834-849.
  2. Wang K L C, Yoshida H, Lurin C, et al. Regulation of ethylene gas biosynthesis by the Arabidopsis ETO1 protein[J]. Nature, 2004, 428(6986): 945-950.

Structured Information