|
|
| (4 intermediate revisions by one other user not shown) |
| Line 2: |
Line 2: |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | OsClpP5 encodes a protein which share 92 % identity to the P5 subunit (AtClpP5) of the ATP-dependent caseinolytic protease from Arabidopsis<ref name="ref1" />. Containing nine exons, OsClpP5 locates in pale-yellow-leaf–variegated (pyl-v) allele in chromosome 3(Figure 1)[[File:clpp.jpg|right|thumb|430px|'''Figure 1.''' ''Characterization of the pale-yellow-leaf–variegated (pyl-v) allele. <ref name="ref1" />.'']]. A is commonly the transcription start site that upstream of 94-bp of the start codon in OsClpP5 in T-65. |
| | + | Pyl gene is indispensable for the growth of the plant. The phenotypes are shown as Figure 2 [[File:clpp5.jpg|right|thumb|430px|'''Figure 1.''' ''Phenotypes of pale-yellow-leaf variegated (pyl-v) (a), pyl-stable (pyl-stb) (b), pyl-stb treated with 5-azacytidine (5-azaC) (c).<ref name="ref2" />. '']]. |
| | ===Function=== | | ===Function=== |
| | Please input function information here. | | Please input function information here. |
| Line 14: |
Line 16: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * National Institute for Basic Biology, Okazaki, Japan |
| | + | * Research Institute for Bioresources, Okayama University, Okayama, Japan |
| | + | * Faculty of Agriculture, Hokkaido University, Sapporo, Japan |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | * <ref name="ref1"> |
| | + | Adam, Z. and Clarke, A.K. (2002) Cutting edge of chloroplast proteolysis.Trends Plant Sci. 7, 451–456. |
| | + | </ref> |
| | + | |
| | + | * <ref name="ref2"> |
| | + | Kazuo Tsugane, Masahiko Maekawa, Kyoko Takagi, et al. An active DNA transposon nDart causing leaf variegation and mutable dwarfism and its related elements in rice. The Plant Journal (2006) 45, 46–57. |
| | + | </ref> |
| | + | |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os03g0308100|
| |
| − | Description = Peptidase S14, ClpP family protein|
| |
| − | Version = NM_001056437.2 GI:297600815 GeneID:4332615|
| |
| − | Length = 2967 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0308100, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:11017466..11020432|
| |
| − | CDS = 11017711..11017908,11018127..11018215,11018308..11018342,11018998..11019070,11019153..11019198<br>,11019648..11019740,11019822..11019945,11020065..11020154,11020238..11020338<br>|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:11017466..11020432
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:11017466..11020432
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgaccaccaccaccaccccctcctcctctctcaccgcccctctcctccgcccgagctcgaacgcgaaccccgccccgagatctctgccgctcctcaggagccggaggtgcgctcgggccgtggcgaccgccgccgccgccgctggccacggggccgctcatcagaggagcgggatttggtcgatcagggatgatttggtggtgccgaggtcgccctacttccctgtggagtatgcgtcggggcaggaacgcgggccatcgcccatggtgatggagcggttccagagcgtcgtcagccagctcttccagcacaggattatccggtgtggtggacccgtggaggatgatatggcgaacatcatcgttgcccagctgctatatctcgatgccatcgatcctaacaaggatatcattatgtatgtgaattctcctggaggatcagtgacagctgggatggccatattcgacacgatgaagcatatcagacctgatgtttccacagtttgtattggacttgctgcaagtatgggagcttttctgcttagtgctgggacaaaagggaagcgatacagcttacctaactcaagaataatgatccatcaacctctcggaggagcccaaggacaagagactgatcttgagatccaggctaatgagatgctgcatcacaaggctaacctgaatggatacctagcataccacactgggcagcccctagataagatcaacgtagatactgaccgtgattacttcatgagcgcgaaggaggcaaaggagtatggtctaattgatggagttatcatgaatccccttaaagcccttcaaccgcttcctgcttctagttag</cdnaseq>|
| |
| − | AA = <aaseq>MATTTTTPSSSLTAPLLRPSSNANPAPRSLPLLRSRRCARAVAT AAAAAGHGAAHQRSGIWSIRDDLVVPRSPYFPVEYASGQERGPSPMVMERFQSVVSQL FQHRIIRCGGPVEDDMANIIVAQLLYLDAIDPNKDIIMYVNSPGGSVTAGMAIFDTMK HIRPDVSTVCIGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGQETDLEIQA NEMLHHKANLNGYLAYHTGQPLDKINVDTDRDYFMSAKEAKEYGLIDGVIMNPLKALQ PLPASS</aaseq>|
| |
| − | DNA = <dnaseqindica>2525..2722#2218..2306#2091..2125#1363..1435#1235..1280#693..785#488..611#279..368#95..195#acacactattctctcttcttcttaccaccctctcccggataagaggcgcaaccaaagcccccaccctcgcccaaaacccccacgagccgcggccatggcgaccaccaccaccaccccctcctcctctctcaccgcccctctcctccgcccgagctcgaacgcgaaccccgccccgagatctctgccgctcctcaggttcactcccctcttccccctccctcctcactctactctgtcgtggctccactcgctctaccctaactgactcggtcttgcaggagccggaggtgcgctcgggccgtggcgaccgccgccgccgccgctggccacggggccgctcatcagaggagcgggatttggtcgatcaggtgggggggggggttgattttgtgacgaaccatttgtagctctgcatcgtctggttgggggagggttgggtggggatgcgagggagctgatgatgctgtggttgttgtgtgtttcgtagggatgatttggtggtgccgaggtcgccctacttccctgtggagtatgcgtcggggcaggaacgcgggccatcgcccatggtgatggagcggttccagagcgtcgtcagccagctcttccagcacgtacgggagcactagattgttgcacaagtttatttgtggagggttctgtgtgctgtctgactctgtgtgattgtggaacagaggattatccggtgtggtggacccgtggaggatgatatggcgaacatcatcgttgcccagctgctatatctcgatgccatcgatcctaacaaggtgaaaatgatgaataagacgctatccgacatccaattcctatttcctataccaatagctgccaaagctttgttacgaactgcttactctaaaaatactgaggcgatgaagggagtggtgctcactgtatttacaattttacatgaactatatggtgtcttgttttaatggatgattgttgttaatccccagataaaatggtccttttatctgtcaatactcaataccagacactaaagtaccattgctactcactttgggttatatatgagtccttgttagtcctagcttaggctgtgattcagttatgtagttgtgacctcaaaccttatggtgaggcttgtattgcgatttcatctaccaggacctgattccatggcaccatatattcatgatttcgtacttacattcagtactcgattcttgacttcctctcaacattcctgtaggatatcattatgtatgtgaattctcctggaggatcagtgacagctggtaataactcatccattttttttcatagctccatctcactcttggaacatttgtttcacaccaaactgcattttgtgtttagggatggccatattcgacacgatgaagcatatcagacctgatgtttccacagtttgtattggacttgctgcaaggtatttagtactgaaaaactgatatccttaattggcaattgatttggatttgtgacgctctgcaatttatgcatcttataatgtttaattctttagcattctgttcaattattcaagtaagggtttcagttgctatattctggtcaacatgtaaacatgcacctgtttccagttgtatatcccgcctaattccttctcctttcataatgtgggaagcacaccaaatcattgattgtatcaggcatgttctattcagtataatcagcctcaatctaggattttgggttgactgagatcaaattttgtgctgcgcatgttagcaaagaagctttgtaccctcatacctccttaatcaaaatataatttttcaaactttatgtttgtgagaatccatatggatgttgataacaggagagtttcttcatttcatgtactttatcaatgtttagccaacaatgcaaattcaggagtgcttatcagtattccaggcacacagtttattagtaaaacatgataactgttcagctgcaaatctgtaaccatttctttctcattgtacttttggaatgctctcttttagctatccatcttgccttaagttgcattgatttcggttatgcactcattttcactgttttgtttccctttttggcagtatgggagcttttctgcttagtgctgggacaaaaggtaattgagtgattgttaatgcaagtactacatttattctacaactagactgatctgaatccttgaatactgtacttgtgaatgtaacacagggaagcgatacagcttacctaactcaagaataatgatccatcaacctctcggaggagcccaaggacaagagactgatcttgagatccaggtaaatccacaaagttaaattgtgtttttatcaagatcaggacgacatctcaatagcaaataattaaccatatcattgtttctctcttgccggtatatggttcgatctacatgaaatacatttatttccacaagcgaatagcaactccgctggctttctattgttacttgtatcaccagaagatttttctgtcactgattttccattatttcttttaggctaatgagatgctgcatcacaaggctaacctgaatggatacctagcataccacactgggcagcccctagataagatcaacgtagatactgaccgtgattacttcatgagcgcgaaggaggcaaaggagtatggtctaattgatggagttatcatgaatccccttaaagcccttcaaccgcttcctgcttctagttagccatggagtgctcaatctccacggagcattttttggttatcttttagaactgttattgcatccactgtttttattagcttggcaagatagttttgcgattccacaagcaaccacatcctgaggcttcaaagtttgtacaatacagatgtactactaggaggatatcttctgcgatgaatattgcaacttatttgatgtactattaggaggatatcttctgcgatgaatattgcaacttatttgat</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056437.2 RefSeq:Os03g0308100]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
OsClpP5 encodes a protein which share 92 % identity to the P5 subunit (AtClpP5) of the ATP-dependent caseinolytic protease from Arabidopsis
[1]. Containing nine exons, OsClpP5 locates in pale-yellow-leaf–variegated (pyl-v) allele in chromosome 3(Figure 1)
Figure 1. Characterization of the pale-yellow-leaf–variegated (pyl-v) allele. [1]. . A is commonly the transcription start site that upstream of 94-bp of the start codon in OsClpP5 in T-65.
Pyl gene is indispensable for the growth of the plant. The phenotypes are shown as Figure 2
Figure 1. Phenotypes of pale-yellow-leaf variegated (pyl-v) (a), pyl-stable (pyl-stb) (b), pyl-stb treated with 5-azacytidine (5-azaC) (c).[2]. .
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
- National Institute for Basic Biology, Okazaki, Japan
- Research Institute for Bioresources, Okayama University, Okayama, Japan
- Faculty of Agriculture, Hokkaido University, Sapporo, Japan
References
- ↑ 1.0 1.1
Adam, Z. and Clarke, A.K. (2002) Cutting edge of chloroplast proteolysis.Trends Plant Sci. 7, 451–456.
- ↑
Kazuo Tsugane, Masahiko Maekawa, Kyoko Takagi, et al. An active DNA transposon nDart causing leaf variegation and mutable dwarfism and its related elements in rice. The Plant Journal (2006) 45, 46–57.
Structured Information