Difference between revisions of "Os03g0322900"

From RiceWiki
Jump to: navigation, search
(Structured Information)
Line 45: Line 45:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os03g0322900|
 
Description = Apolipoprotein/apolipophorin domain containing protein|
 
Version = NM_001056505.2 GI:297600839 GeneID:4332688|
 
Length = 1373 bp|
 
Definition = Oryza sativa Japonica Group Os03g0322900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:11749963..11751335|
 
CDS = 11750482..11751243|
 
GCID = <gbrowseImage1>
 
name=NC_008396:11749963..11751335
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:11749963..11751335
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgtcgaggcaggacaggagggaggcgcgggccgaggccgacgcgcggcgcgcggcggaggagatcgcgcgggcgcgggacgagcgcgtcatgcaggcggaggtggacgcccggtcggccgcggacgagatcgcccgcgcccgcgccgaccgcggcgccgccacgatgggcgccgacaccgcccaccacgccgccggcggcggcggcatcctggagagcgtgcaggagggcgccaagtcgttcgtgagcgccgtcgggcgcacgttcggcggcgcgagggacaccgccgcggagaagacctcccagacggcggacgccacccgggacaagctcggcgagtacaaggactacaccgccgacaaggcccgcgagaccaacgacagcgtcgcgcggaagacgaacgagacggcggacgcctcccgtgacaagctcggcgagtacaaggactacaccgccgacaagacccgggagaccaaggacgccgtggcgcagaaggcgagcgacgcctccgaggcgaccaagaacaagctgggcgagtacaaggacgcgctggccaggaagacgcgcgacgccaaggacaccaccgcgcagaaggcgacggagttcaaggacggcgtgaaggcgacggcgcaggagacgagggacgccaccgccgacacggcgaggaaggccaaggacgccaccaaggacaccacccagaccgccgccgacaaggccagggagacggccgccacccacgacgacgccaccgacaagtaa</cdnaseq>|
 
AA = <aaseq>MASRQDRREARAEADARRAAEEIARARDERVMQAEVDARSAADE                    IARARADRGAATMGADTAHHAAGGGGILESVQEGAKSFVSAVGRTFGGARDTAAEKTS                    QTADATRDKLGEYKDYTADKARETNDSVARKTNETADASRDKLGEYKDYTADKTRETK                    DAVAQKASDASEATKNKLGEYKDALARKTRDAKDTTAQKATEFKDGVKATAQETRDAT                    ADTARKAKDATKDTTQTAADKARETAATHDDATDK</aaseq>|
 
DNA = <dnaseqindica>93..854#actcgtgcactgcgaagctacacttaccactgcaaccactgatcacagagctagaggttcacttaggcgaagcttaattacacagagcgcccatggcgtcgaggcaggacaggagggaggcgcgggccgaggccgacgcgcggcgcgcggcggaggagatcgcgcgggcgcgggacgagcgcgtcatgcaggcggaggtggacgcccggtcggccgcggacgagatcgcccgcgcccgcgccgaccgcggcgccgccacgatgggcgccgacaccgcccaccacgccgccggcggcggcggcatcctggagagcgtgcaggagggcgccaagtcgttcgtgagcgccgtcgggcgcacgttcggcggcgcgagggacaccgccgcggagaagacctcccagacggcggacgccacccgggacaagctcggcgagtacaaggactacaccgccgacaaggcccgcgagaccaacgacagcgtcgcgcggaagacgaacgagacggcggacgcctcccgtgacaagctcggcgagtacaaggactacaccgccgacaagacccgggagaccaaggacgccgtggcgcagaaggcgagcgacgcctccgaggcgaccaagaacaagctgggcgagtacaaggacgcgctggccaggaagacgcgcgacgccaaggacaccaccgcgcagaaggcgacggagttcaaggacggcgtgaaggcgacggcgcaggagacgagggacgccaccgccgacacggcgaggaaggccaaggacgccaccaaggacaccacccagaccgccgccgacaaggccagggagacggccgccacccacgacgacgccaccgacaagtaaactcgccggaacaccatccgcaagcacgtagtgctcctagctatcgataataatgtccacattttttttgttgatgatgcagggggcaagggcagggcctgctcggggcgctggggaacgtgacgggggcgatcaaggagaagctgacggtgagcccggcggcgacgcaggagcatctgggcggcggcgaggagcgcgcggtgaaggagcgcgcggcggagaaggcggcgtcggtgtacttcgaggagaaggaccggctgacgagggagcgcgcggcggagcgggtggacaagtgcgtggagaagtgcgtcgaggggtgccccgacgccacctgcgcccaccgccacggcaagatgtgatcccccatgagcgcggtggacgactaataaaaaaaactcccagcatgttaacctttgtgtttcaagtttcactagctgcttttattttgctttcgttaagtttccactaccgtgtatgttccttctggtaatctaagtgcagtggtgctgaaatctttat</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056505.2 RefSeq:Os03g0322900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Revision as of 05:49, 12 June 2015

OsLEA3-2 encodes a group 3 LEA proteins in rice[1][2].

Annotated Information

Function

  • In vitro analysis showed that OsLEA3-2 was able to protect LDH from aggregation on freezing and inactivation on desiccation. OsLEA3-2 plays an important role in tolerance to abiotic stresses and the maturation process of the embryo[1].
  • OsLEA3-2 is able to enhance drought tolerance in the transgenic rice plants. The OsLEA3-2 gene enhanced salt and osmotic stress tolerance when expressed in Saccharomyces crevisiae[1].

Mutation

The transgenic Arabidopsis seedlings showed better growth on MS media supplemented with 150 mM mannitol or 100 mM NaCl as compared with wild type plants. The transgenic rice also showed significantly stronger growth performance than control under salinity or osmotic stress conditions and were able to recover after 20 days of drought stress[1].

Expression

  • Expression of the Os03g0322900 gene was strongly and consistently induced in Fe-deficient leaves, and was moderately induced in Fe-deficient roots in one of the two sets of experiments[2].
  • OsLEA3-2 does not express in vegetative tissues under normal conditions, but was found to be only expressed in the embryo and can be induced by abiotic stresses. While no transcript was detected in the seedlings treated with low temperature stress or ABA, OsLEA3-2 expression was detected when the rice was grown in Hoagland with ABA. OsLEA3-2 was induced by the ABA, but assimilation was not possible through a topographical application on rice leaves. Mannitol and salt stress also induced OsLEA3-2 gene expression in the shoot base and leaves, while the PEG treatment induced gene expression in both roots and shoots[1].
  • OsLEA3-2 was also inserted into pHB vector and overexpressed in Arabidopsis and rice. Overexpression of OsLEA3-2 in yeast improved growth performance compared with control under salt- and osmotic-stress conditions[1].

Subcellular localization

The coding protein localizes to the nucleus, which means that OsLEA3-2 is a nucleus- localized protein[1].

Evolution

The deduced amino acid sequence shares 42 and 36% amino acid identities with LEA3 of Arabidopsis thaliana and Oryza sativa, respectively. Predicted proteins of Oryza LEA3-2 showed a preponderance of Ala, Thr, Asp, Glu, Lys, Arg and Gly that constitute 20.6%, 10.2%, 10%, 9.3%, 9.3%, 9.3%, and 7.3%, respectively, and lack Trp. OsLEA3-2 has 16 11-mer repeating units, TKDA(A/T)ADK(A/T)RE. Hydropathy analysis showed that OsLEA3-2 is a hydrophilic protein[1].

Knowledge Extension

  • Late embryogenesis abundant (LEA) proteins are involved in tolerance to drought, cold and high salinity in many different organisms. A cDNA clone oslea3, encoding a group 3 late-embryogenesis abundant (LEA) protein was isolated from roots of rice seedlings (Oryza sativa L.). The encoded OSLEA3 protein has previously been found to accumulate to higher levels in roots of two salttolerant compared to a salt-sensitive rice variety in response to abscisic acid (ABA)[3].
  • Because of the abundance of LEA proteins in desiccation-tolerant embryos of mature seeds and for their unusual structural characteristics an involvement in the acquisition of dehydration tolerance had been proposed[1].

Labs working on this gene

  • Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China
  • Graduate University of the Chinese Academy of Sciences, Beijing, People’s Republic of China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Duan J, Cai W. OsLEA3-2, an abiotic stress induced gene of rice plays a key role in salt and drought tolerance[J]. PLoS One, 2012, 7(9): e45117.
  2. 2.0 2.1 Kobayashi T, Itai R N, Ogo Y, et al. The rice transcription factor IDEF1 is essential for the early response to iron deficiency, and induces vegetative expression of late embryogenesis abundant genes[J]. The Plant Journal, 2009, 60(6): 948-961.
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3

Structured Information