Difference between revisions of "Os03g0327800"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Structured Information)
 
(6 intermediate revisions by one other user not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
 
 +
*Os03g0327800 encoding a Oryza sativa NAC-like, activated by apetala3/pistillata (OsNAP). Overexpression of OsNAP significantly promoted senescence, whereas knockdown of OsNAP produced a marked delay of senescence, confirming the role of this gene in the development of rice senescence.
 +
 
 +
*ABA Participates in Leaf Senescence and the expression of OsNAP can be induced by ABA. ABA-mediated leaf senescence might be dependent on the modulation of OsNAP expression, which, in turn, either directly or indirectly regulates the expression of senescence-associated genes (SAGs). Also, this is a feedback mechanism between ABA and OsNAP, OsNAP can inhibit the expression of key ABA biosynthesis genes.
 +
 
 +
 
 +
[[File:nap1.jpg]]
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* OsNAP is expressed preferentially in the leaf blade, leaf sheath, and endosperm with a low, but still detectable, level of expression in the root, culm,
 +
and young panicle.
 +
 
 +
[[File:nap2.jpg]]
 +
 
 +
 
 +
*OsNAP transcripts were higher in old, senescing leaves than in young, green leaves.
 +
 
 +
[[File:nap3.jpg]]
 +
 
 +
*OsNAP expression in flag leaves showed that, although the number of OsNAP transcripts increased gradually before heading, it increased dramatically with the beginning of grain filling.(The red arrow indicates the flowering time)
 +
 
 +
[[File:nap4.jpg]]
 +
 
 +
*OsNAP expression decreased gradually from the tip to the base of a fully expanded leaf.
 +
 
 +
[[File:nap5.jpg]]
 +
 
 +
*ABA can induce the expression of OsNAP, and in ABA biosynthetic mutants (aba1 and aba2) the expression is decreased.
 +
 
 +
[[File:nap6.jpg]]
  
 
===Mutation and Phenotype===
 
===Mutation and Phenotype===
Please input evolution information here.
+
ps1-D is a dominant mutation caused by the T-DNA insertion.
 +
 
 +
[[File:nap7.jpg]]
 +
 
 +
PS1 contains a typical NAC structure at the N terminus. It belongs to the Va (1)/NAP subfamily of NAC proteins, which has three members in Arabidopsis, six members in rice, and five members in maize. Detailed domain analysis showed that the C-terminal region (amino acids 181–392) possessed high transcriptional activation activity,fragment containing subdomains 3 (amino acids 64–100) and 4 (amino acids 100–142) of the NAC motif showed stronger repression activity, whereas subdomains 1 and 2 (amino acids 1–64) and 5 (amino acids 157–181) exhibited weaker repression activity.
 +
 
 +
[[File:nap8.jpg]]
 +
 
 +
after grain filling, ps1-D mutants had an accelerated yellowing phenotype, displaying senescence 7–10 d earlier than the wild-type plants. In addition, after flowering, ps1-D mutants also exhibited faster chlorophyll degradation than the wild type plants.
 +
 
 +
[[File:nap9.jpg]]
  
 +
OsNAP RNAi lines can delay the senescence.
 +
 +
[[File:nap10.jpg]]
  
 
===other information===
 
===other information===
  
You can also add sub-section(s) at will.
+
*Primers used in this study for molecular cloning of PS1
 +
 
 +
[[File:nap11.jpg]]
 +
 
 +
*Primers used to generate DNA constructs
 +
 
 +
[[File:nap12.jpg]]
 +
[[File:nap13.jpg]]
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology,
 +
Chinese Academy of Sciences
 +
 
 +
*University of Chinese Academy of Sciences, Beijing 100049, China; and cSchool of Agriculture and Food Science, Zhejiang Agricultural and Forestry University, Hangzhou
  
 
==References==
 
==References==
Please input cited references here.
+
Chengzhen Liang, Yiqin Wang, Yana Zhu, et al. OsNAP connects abscisic acid and leaf senescence by fine-tuning abscisic acid biosynthesis and directly
 +
targeting senescence-associated genes in rice. PNAS, 2014
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os03g0327800|
 
Description = No apical meristem (NAM) protein domain containing protein|
 
Version = NM_001056532.2 GI:297600855 GeneID:4332717|
 
Length = 2417 bp|
 
Definition = Oryza sativa Japonica Group Os03g0327800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:12024636..12027052|
 
CDS = 12026216..12026613,12026708..12026873|
 
GCID = <gbrowseImage1>
 
name=NC_008396:12024636..12027052
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:12024636..12027052
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggttctgtcgaacccggcgatgctgccgccggggttccggttccacccgacggacgaggagctgatcgtgcactacctccgcaaccgggccgcctcctcgccgtgccccgtctccatcatcgccgacgtcgacatctacaagttcgatccgtgggacctcccatccaaggagaattacggggacagggagtggtacttcttcagcccgagggaccgcaagtacccgaacgggatccggccgaaccgcgccgcgggctccggctactggaaggccaccggcaccgacaagcccatccacagcagcggcggcgcggcgaccaacgagagcgtcggcgtcaagaaggcgctcgtcttctacaagggccgcccgcccaagggcaccaagaccaactggatcatgcacgagtaccgcctcgccgccgcagacgcccacgccgccaacacctaccgccccatgaagttccgcaacacctccatgagggtaagcaagctccatctacgttacctagcagccagattcaaattatctaaaccaaacaacttaattatgaacaaaccctag</cdnaseq>|
 
AA = <aaseq>MVLSNPAMLPPGFRFHPTDEELIVHYLRNRAASSPCPVSIIADV                    DIYKFDPWDLPSKENYGDREWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSS                    GGAATNESVGVKKALVFYKGRPPKGTKTNWIMHEYRLAAADAHAANTYRPMKFRNTSM                    RVSKLHLRYLAARFKLSKPNNLIMNKP</aaseq>|
 
DNA = <dnaseqindica>440..837#180..345#aaattcgagccctcctccatctctcgcctcctcttgatacaagctcgaccctgatagatctcatagatcatagctgagaggggatcgagtggcttgatcttggaagtgagcagctatagctagataggttttgcttgtgcagggaggtgtgtgttgtgtgtgggtgactgccggagacgatggttctgtcgaacccggcgatgctgccgccggggttccggttccacccgacggacgaggagctgatcgtgcactacctccgcaaccgggccgcctcctcgccgtgccccgtctccatcatcgccgacgtcgacatctacaagttcgatccgtgggacctcccatgttagtacccaccctcacagctcgccgcgatcgatcgatcactgatttgcaattaatttcgttggtgatcgacttgtgttttgatttgcatcagccaaggagaattacggggacagggagtggtacttcttcagcccgagggaccgcaagtacccgaacgggatccggccgaaccgcgccgcgggctccggctactggaaggccaccggcaccgacaagcccatccacagcagcggcggcgcggcgaccaacgagagcgtcggcgtcaagaaggcgctcgtcttctacaagggccgcccgcccaagggcaccaagaccaactggatcatgcacgagtaccgcctcgccgccgcagacgcccacgccgccaacacctaccgccccatgaagttccgcaacacctccatgagggtaagcaagctccatctacgttacctagcagccagattcaaattatctaaaccaaacaacttaattatgaacaaaccctagcagctggatcttgctatcgatggagtagagagtagatcgtctattattcatctctgtctgatgtgctagtgcacttgcacagttgcacaccgtggtttttttgggtggttgtttctgatgatcgatacgtgttcgtcggcacgtcagtattatcgcatcggtttgtgccttgccaatggacgcaactcgctgcttttagtgtgtctgttttaaagagggtgttctttaggcaatacttggcatggttgcgcaagtcaatagatccgacaatgatagccacgatgcgtacgtgttgatgactggttcatctctgcatatgcgcgcatgcataccccctgaaattaatcccttctatttttgatactcttaatttcttaatcatatagtatatgcatccgtgtgattgatcgatcgatgtgcgtggatttttgtgcagctggatgactgggtgctgtgccggatctacaagaagagcagccacgcgtcgccgctggccgtgccgccgctctccgaccacgagcaggacgagccgtgcgccctggaggagaacgcgccgctgtacgcgccgtcgtcgtcgagcgccgcatccatgatcttgcagggcgctgccgccggcgccttcccgtcgctgcacgccgccgccgccgctacgcagaggacggcgatgcagaagatcccttccatttccgacctgctcaacgagtactcgctgtcgcagctcttcgacgacggcggcgccgccgccgccgcccccctgcaggagatggcgaggcagcccgaccaccaccaccaccaacaacaacaacacgccctctttggccaccccgtcatgaaccatttcatcgcgaacaacagcatggttcagctcgcgcacctggacccgtcctcctctgcggccgcctcgacgtcggcaggcgccgtcgtcgagccgccggccgtcaccgggaagcgcaagagatcatcggacggaggcgagccgacgatccaggcgctgcctcctgctgccgcggcggccaagaagccgaacggttcatgcgttggtgcaactttccaaataggcagcgccttgcagggatcgtcactgggactgagccaccagatgctgctccactctaacatggggatgaactgatagctcgttcttcgtacataataccacagcctgattaaacactgaacataattgcacatggcgaattgatgatttgaacagtgaggtctatttcgaaagcaaataggtccaaaacgatagatttaaatagtaaatatattgggaaagaaattgtacttaatttgtacttgtgtggactagctaggtcgtccgatcatgcatagctatatagtttgtggtgtgtatacattttttctcatggtactatactactgtgtactcaagctagctcagtactaaagattaattaagctagataggggttgataagactttgagatagacccactagaagtctggaacatgagatcaaggagaatgatgtcaagatcataaagccggatttatagctcatattcatgtaaatcaatcaataagtgattctttaatggcagccactcattttttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056532.2 RefSeq:Os03g0327800]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 05:49, 12 June 2015

Please input one-sentence summary here.

Annotated Information

Function

  • Os03g0327800 encoding a Oryza sativa NAC-like, activated by apetala3/pistillata (OsNAP). Overexpression of OsNAP significantly promoted senescence, whereas knockdown of OsNAP produced a marked delay of senescence, confirming the role of this gene in the development of rice senescence.
  • ABA Participates in Leaf Senescence and the expression of OsNAP can be induced by ABA. ABA-mediated leaf senescence might be dependent on the modulation of OsNAP expression, which, in turn, either directly or indirectly regulates the expression of senescence-associated genes (SAGs). Also, this is a feedback mechanism between ABA and OsNAP, OsNAP can inhibit the expression of key ABA biosynthesis genes.


Nap1.jpg

Expression

  • OsNAP is expressed preferentially in the leaf blade, leaf sheath, and endosperm with a low, but still detectable, level of expression in the root, culm,

and young panicle.

Nap2.jpg


  • OsNAP transcripts were higher in old, senescing leaves than in young, green leaves.

Nap3.jpg

  • OsNAP expression in flag leaves showed that, although the number of OsNAP transcripts increased gradually before heading, it increased dramatically with the beginning of grain filling.(The red arrow indicates the flowering time)

Nap4.jpg

  • OsNAP expression decreased gradually from the tip to the base of a fully expanded leaf.

Nap5.jpg

  • ABA can induce the expression of OsNAP, and in ABA biosynthetic mutants (aba1 and aba2) the expression is decreased.

Nap6.jpg

Mutation and Phenotype

ps1-D is a dominant mutation caused by the T-DNA insertion.

Nap7.jpg

PS1 contains a typical NAC structure at the N terminus. It belongs to the Va (1)/NAP subfamily of NAC proteins, which has three members in Arabidopsis, six members in rice, and five members in maize. Detailed domain analysis showed that the C-terminal region (amino acids 181–392) possessed high transcriptional activation activity,fragment containing subdomains 3 (amino acids 64–100) and 4 (amino acids 100–142) of the NAC motif showed stronger repression activity, whereas subdomains 1 and 2 (amino acids 1–64) and 5 (amino acids 157–181) exhibited weaker repression activity.

Nap8.jpg

after grain filling, ps1-D mutants had an accelerated yellowing phenotype, displaying senescence 7–10 d earlier than the wild-type plants. In addition, after flowering, ps1-D mutants also exhibited faster chlorophyll degradation than the wild type plants.

Nap9.jpg

OsNAP RNAi lines can delay the senescence.

Nap10.jpg

other information

  • Primers used in this study for molecular cloning of PS1

Nap11.jpg

  • Primers used to generate DNA constructs

Nap12.jpg Nap13.jpg

Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology,

Chinese Academy of Sciences

  • University of Chinese Academy of Sciences, Beijing 100049, China; and cSchool of Agriculture and Food Science, Zhejiang Agricultural and Forestry University, Hangzhou

References

Chengzhen Liang, Yiqin Wang, Yana Zhu, et al. OsNAP connects abscisic acid and leaf senescence by fine-tuning abscisic acid biosynthesis and directly targeting senescence-associated genes in rice. PNAS, 2014

Structured Information