Difference between revisions of "Os03g0634400"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os03g0634400| Description = Protein kinase-like domain containing protein| Version = NM_001057253.1 GI:115454234 GeneID:4333516| Length = 1559 b...")
 
(Structured Information)
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
'''''OsCIPK07''''' is a member of '''CIPK genes''' (CIPKs,calcineurin B-like protein interacting protein kinases) in rice<ref name="ref1"/>.
GeneName = Os03g0634400|
+
 
Description = Protein kinase-like domain containing protein|
+
==Annotated Information==
Version = NM_001057253.1 GI:115454234 GeneID:4333516|
+
===Function===
Length = 1559 bp|
+
*[[Os12g0603700|''OsCIPK4'']]:''OsCIPK7'' are gene pairs<ref name="ref2"/>. Expression of ''OsCIPK07'' in the internode is quite unique suggesting related developmental roles<ref name="ref3"/>.
Definition = Oryza sativa Japonica Group Os03g0634400, complete gene.|
+
 
Source = Oryza sativa Japonica Group
+
*''OsCIPK07'', [[Os03g0339900|''OsCIPK10'']], [[Os01g0759400|''OsCIPK12'']], and [[Os12g0113500|''OsCIPK14'']] showed a similar diurnal pattern to ''OsGI''<ref name="ref3"/>.
 +
<br>
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672],[http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524], [http://amigo.geneontology.org/amigo/term/GO:0007165 GO:0007165]
 +
 
 +
===Expression===
 +
*''OsCIPK07'' was '''induced by salinity stress''' and '''ABA treatment'''<ref name="ref1"/>.
 +
 
 +
*In subgroup VII, ''OsCIPK04'' showed down-regulation but expression of ''OsCIPK07'' showed '''fluctuation''' such as downregulation at 2 and 4 h after drought stress and up-regulation
 +
at 6 and 8 h<ref name="ref3"/>.
 +
 
 +
===Evolution===
 +
[[Os12g0603700|''OsCIPK4'']] and ''OsCIPK07'' belong to '''subgroup VII''' of ''OsCIPK'' family<ref name="ref3"/>.
 +
 
 +
===Knowledge Extension===
 +
*Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses<ref name="ref1"/>.
 +
 
 +
*The calcineurin B-like protein–CBL-interacting protein kinase ('''CBL–CIPK''') signaling pathway in plants is a Ca<sup>2+</sup>-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells<ref name="ref4"/>.
 +
 
 +
*As a plant-specific Ca<sup>2+</sup> sensor relaying pathway, the CBL–CIPK pathway has some crosstalk with other signaling pathways. In addition, research has shown that there is crosstalk between the CBL–CIPK pathway and the low-K<sup>+</sup> response pathway, the ABA signaling pathway, the nitrate sensing and signaling pathway, and others<ref name="ref4"/>.
 +
 
 +
==Labs working on this gene==
 +
*Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez
 +
Road, Dhaula Kuan, New Delhi-110021, India
 +
*National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement,
 +
Huazhong Agricultural University, Wuhan 430070, China
 +
*Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
 +
*Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
 +
 
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
 +
</ref>
 +
* <ref name="ref2">
 +
Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
 +
</ref>
 +
* <ref name="ref3">
 +
Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
 +
</ref>
 +
* <ref name="ref4">
 +
Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J].  
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:24986674..24988232|
 
CDS = 24986819..24988162|
 
GCID = <gbrowseImage1>
 
name=NC_008396:24986674..24988232
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:24986674..24988232
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggccgccaccaagagcaaggcggccaagaagggcgctccgctcctcggcaagtacgagctcggccgcctcctcggccgcggcaccttcgccaaggtctaccacgcccgctccctcgcccccggcgccgaccccgtcgccgtcaaggtgctcgacaagcccgacctcgccgccgccggcgccggcatggccacccgcgtcctccgcgaggtcgccgccatgcgccgcctccgccaccccaacgtcctccgcctccacgaggtgctcgccacgcgctccaaggtgtacctcgtcatggagctcgcccccggcggcgacctcctctccaggctcgcctcgctgccgtcgcgccgcctccccgagcacgccgcgcagcgggtgttcctccagctggtgtccgcgctcatctactgccacgcgcggggcgtgtcccaccgcgacgtcaagccgcagaacgtgctcctcgacgcacacggcaacctcaaggtctccgacttcggcctcgccgcgctcccggactcgctccgcgacgacgggcgcctgcacaccgcgtgcggcaccccggcgttcgcggcgcccgaggtgctccgccgcaaggcctacgacggcgccaaggccgacgcgtggtcctgcggcgtcatcctcttcgtcctcctcgccggccacctgccgttcgacgactccaacatcgccgacatgtgccggaaggcgcaccgccgcgagtacgcgctcccgcggtgggtgtcgcagccggcgcgccgcctcgtgtcgcgcctcctcgacccgaacccggccacccgcctcgccgtcgccgagctcgccacccacccgtggttcaagcgctcgctcagcctcgactcgcagctcggcagcctcctcggcggccagccggagcgggagctggcgttccaggcgccgccgccactgaacgcgttcgacatcatatccatgtcgccggggctcgacctgtccgggctgttcggcgagagcaagcgccgccgggagaagcggttcgtgacgacggcgtcgccggagcggacggtggagcggctcggccaggcgggcgccaagctcggctacttcatggtgggcaagaagggcgtcgaacgcctgcccctgggcggcctctcgggcctcgtcgccatgtccatggagatgtcggaggtgtcgccgtcgatgatgctcgtcgagctgaggctggagggaggcgacgacggcgacggcgacggcggtgccgaggagttcgggtgggaggagctcagggcggagctcggcgacgacgtggtgatggcatggcatggctgcgatggagggaagaaagacaaggaagggattcttttgtag</cdnaseq>|
 
AA = <aaseq>MAATKSKAAKKGAPLLGKYELGRLLGRGTFAKVYHARSLAPGAD                    PVAVKVLDKPDLAAAGAGMATRVLREVAAMRRLRHPNVLRLHEVLATRSKVYLVMELA                    PGGDLLSRLASLPSRRLPEHAAQRVFLQLVSALIYCHARGVSHRDVKPQNVLLDAHGN                    LKVSDFGLAALPDSLRDDGRLHTACGTPAFAAPEVLRRKAYDGAKADAWSCGVILFVL                    LAGHLPFDDSNIADMCRKAHRREYALPRWVSQPARRLVSRLLDPNPATRLAVAELATH                    PWFKRSLSLDSQLGSLLGGQPERELAFQAPPPLNAFDIISMSPGLDLSGLFGESKRRR                    EKRFVTTASPERTVERLGQAGAKLGYFMVGKKGVERLPLGGLSGLVAMSMEMSEVSPS                    MMLVELRLEGGDDGDGDGGAEEFGWEELRAELGDDVVMAWHGCDGGKKDKEGILL</aaseq>|
 
DNA = <dnaseqindica>71..1414#atagtaaccagctgctgctgctgccgccctcttctttgtgttgccttgttgttggtgtcgcgcgcccgccatggccgccaccaagagcaaggcggccaagaagggcgctccgctcctcggcaagtacgagctcggccgcctcctcggccgcggcaccttcgccaaggtctaccacgcccgctccctcgcccccggcgccgaccccgtcgccgtcaaggtgctcgacaagcccgacctcgccgccgccggcgccggcatggccacccgcgtcctccgcgaggtcgccgccatgcgccgcctccgccaccccaacgtcctccgcctccacgaggtgctcgccacgcgctccaaggtgtacctcgtcatggagctcgcccccggcggcgacctcctctccaggctcgcctcgctgccgtcgcgccgcctccccgagcacgccgcgcagcgggtgttcctccagctggtgtccgcgctcatctactgccacgcgcggggcgtgtcccaccgcgacgtcaagccgcagaacgtgctcctcgacgcacacggcaacctcaaggtctccgacttcggcctcgccgcgctcccggactcgctccgcgacgacgggcgcctgcacaccgcgtgcggcaccccggcgttcgcggcgcccgaggtgctccgccgcaaggcctacgacggcgccaaggccgacgcgtggtcctgcggcgtcatcctcttcgtcctcctcgccggccacctgccgttcgacgactccaacatcgccgacatgtgccggaaggcgcaccgccgcgagtacgcgctcccgcggtgggtgtcgcagccggcgcgccgcctcgtgtcgcgcctcctcgacccgaacccggccacccgcctcgccgtcgccgagctcgccacccacccgtggttcaagcgctcgctcagcctcgactcgcagctcggcagcctcctcggcggccagccggagcgggagctggcgttccaggcgccgccgccactgaacgcgttcgacatcatatccatgtcgccggggctcgacctgtccgggctgttcggcgagagcaagcgccgccgggagaagcggttcgtgacgacggcgtcgccggagcggacggtggagcggctcggccaggcgggcgccaagctcggctacttcatggtgggcaagaagggcgtcgaacgcctgcccctgggcggcctctcgggcctcgtcgccatgtccatggagatgtcggaggtgtcgccgtcgatgatgctcgtcgagctgaggctggagggaggcgacgacggcgacggcgacggcggtgccgaggagttcgggtgggaggagctcagggcggagctcggcgacgacgtggtgatggcatggcatggctgcgatggagggaagaaagacaaggaagggattcttttgtaggacatggactttgtcacatgtatgatgatgtatattagtaggattttgtggcattgttgtgtcaaagattatagattgttagttcaatctaattacgatgttttgtgactaaattgttggtaggaatggatctagatcatttgtg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057253.1 RefSeq:Os03g0634400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 05:56, 12 June 2015

OsCIPK07 is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases) in rice[1].

Annotated Information

Function

  • OsCIPK4:OsCIPK7 are gene pairs[2]. Expression of OsCIPK07 in the internode is quite unique suggesting related developmental roles[3].


GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524, GO:0007165

Expression

  • OsCIPK07 was induced by salinity stress and ABA treatment[1].
  • In subgroup VII, OsCIPK04 showed down-regulation but expression of OsCIPK07 showed fluctuation such as downregulation at 2 and 4 h after drought stress and up-regulation

at 6 and 8 h[3].

Evolution

OsCIPK4 and OsCIPK07 belong to subgroup VII of OsCIPK family[3].

Knowledge Extension

  • Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses[1].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[4].
  • As a plant-specific Ca2+ sensor relaying pathway, the CBL–CIPK pathway has some crosstalk with other signaling pathways. In addition, research has shown that there is crosstalk between the CBL–CIPK pathway and the low-K+ response pathway, the ABA signaling pathway, the nitrate sensing and signaling pathway, and others[4].

Labs working on this gene

  • Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez

Road, Dhaula Kuan, New Delhi-110021, India

  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement,

Huazhong Agricultural University, Wuhan 430070, China

  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea

References

  1. 1.0 1.1 1.2 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  2. Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
  3. 3.0 3.1 3.2 3.3 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  4. 4.0 4.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J].

Structured Information