Difference between revisions of "Os03g0657000"

From RiceWiki
Jump to: navigation, search
(Expression)
(Structured Information)
 
(4 intermediate revisions by one other user not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
 
  
===Expression===
 
Please input expression information here.
 
 
TBP is a subunit of the eukaryotic transcription factor TFIID. TFIID is the first protein to bind to DNA during the formation of the pre-initiation transcription complex of RNA polymerase II (RNA Pol II). Binding of TFIID to the TATA box in the promoter region of the gene initiates the recruitment of other factors required for RNA Pol II to begin transcription. Some of the other recruited transcription factors include TFIIA, TFIIB, and TFIIF. Each of these transcription factors is formed from the interaction of many protein subunits, indicating that transcription is a heavily regulated process.
 
TBP is a subunit of the eukaryotic transcription factor TFIID. TFIID is the first protein to bind to DNA during the formation of the pre-initiation transcription complex of RNA polymerase II (RNA Pol II). Binding of TFIID to the TATA box in the promoter region of the gene initiates the recruitment of other factors required for RNA Pol II to begin transcription. Some of the other recruited transcription factors include TFIIA, TFIIB, and TFIIF. Each of these transcription factors is formed from the interaction of many protein subunits, indicating that transcription is a heavily regulated process.
  
Line 17: Line 14:
 
TBP's C-terminus composes of a helicoidal shape that (incompletely) complements the T-A-T-A region of DNA. It is interesting to note that this incompleteness allows DNA to be passively bent on binding.
 
TBP's C-terminus composes of a helicoidal shape that (incompletely) complements the T-A-T-A region of DNA. It is interesting to note that this incompleteness allows DNA to be passively bent on binding.
  
For information on the use of TBP in cells see: RNA polymerase I, RNA polymerase II, and RNA polymerase III.
+
The TATA-box binding protein (TBP) is required for the initiation of transcription by RNA polymerases I, II and III, from promoters with or without a TATA box. TBP associates with a host of factors, including the general transcription factors TFIIA, -B, -D, -E, and -H, to form huge multi-subunit pre-initiation complexes on the core promoter. Through its association with different transcription factors, TBP can initiate transcription from different RNA polymerases. There are several related TBPs, including TBP-like (TBPL) proteins.
 +
 
 +
===Expression===
  
The TATA-box binding protein (TBP) is required for the initiation of transcription by RNA polymerases I, II and III, from promoters with or without a TATA box. TBP associates with a host of factors, including the general transcription factors TFIIA, -B, -D, -E, and -H, to form huge multi-subunit pre-initiation complexes on the core promoter. Through its association with different transcription factors, TBP can initiate transcription from different RNA polymerases. There are several related TBPs, including TBP-like (TBPL) proteins.
+
The TATA-binding protein (TBP) is a general transcription factor that binds specifically to a DNA sequence called the TATA box. This DNA sequence is found about 30 base pairs upstream of the transcription start site in some eukaryotic gene promoters. TBP, along with a variety of TBP-associated factors, make up the TFIID, a general transcription factor that in turn makes up part of the RNA polymerase II preinitiation complex. As one of the few proteins in the preinitiation complex that binds DNA in a sequence-specific manner, it helps position RNA polymerase II over the transcription start site of the gene. However, it is estimated that only 10-20% of human promoters have TATA boxes. Therefore, TBP is probably not the only protein involved in positioning RNA polymerase II.
 +
 
 +
TBP is involved in DNA melting (double strand separation) by bending the DNA by 80° (the AT-rich sequence to which it binds facilitates easy melting). The TBP is an unusual protein in that it binds the minor groove using a β sheet.
 +
 
 +
Another distinctive feature of TBP is a long string of glutamines in the N-terminus of the protein. This region modulates the DNA binding activity of the C-terminus, and modulation of DNA-binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease.
  
 
===Evolution===
 
===Evolution===
Line 33: Line 36:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os03g0657000|
 
Description = TATA-binding protein TBP2|
 
Version = NM_001057347.1 GI:115454422 GeneID:4333619|
 
Length = 4417 bp|
 
Definition = Oryza sativa Japonica Group Os03g0657000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:26394921..26399337|
 
CDS = 26395103..26395188,26396166..26396253,26396861..26396932,26397856..26397906,26397981..26398025<br>,26398124..26398216,26398302..26398403,26398478..26398551|
 
GCID = <gbrowseImage1>
 
name=NC_008396:26394921..26399337
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:26394921..26399337
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggcggaggcggcagcggcgctggaggggagcgagcccgtggacctggccaagcacccctccggcatcatccccacgctccaaaacatcgtatcgacggtcaatttggattgcaaattagacctcaaagctatagctttgcaagctcgcaatgcagaatataatccaaagcgttttgctgcggttatcatgagaataagagaaccaaaaactacagctctgatatttgcatcgggtaaaatggtctgtactggggcaaagagtgaacaacaatccaagcttgcagcaagaaagtacgctcgtattatccagaagcttggctttcctgctaaattcaaggatttcaagattcagaacattgttggctcttgtgatgttaaatttccaatcaggctggagggacttgcatattctcatggtgctttctcaagttatgagccagaactctttcctggtctgatatatcggatgaagcaaccaaagattgttcttctgatttttgtttcaggcaagattgttttgaccggagcaaaggtgagggatgagacgtataccgcctttgagaacatataccctgtgctaacggagttcagaaaagtccagcagtga</cdnaseq>|
 
AA = <aaseq>MAAEAAAALEGSEPVDLAKHPSGIIPTLQNIVSTVNLDCKLDLK                    AIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYAR                    IIQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQ                    PKIVLLIFVSGKIVLTGAKVRDETYTAFENIYPVLTEFRKVQQ</aaseq>|
 
DNA = <dnaseqindica>183..268#1246..1333#1941..2012#2936..2986#3061..3105#3204..3296#3382..3483#3558..3631#gcgagagcgcatagataaccctagcctcccccttcctcttcctctcctccttctctcgatctctataaaagacctcggatttcgaattcctccgccccgcgcgcgcgcgccacctcccccacgcccgtcgcgcccttttttttgggggtgggattcgcctggtcaagtgccatcgtcggatcatggcggcggaggcggcagcggcgctggaggggagcgagcccgtggacctggccaagcacccctccggcatcatccccacgctccagtaagtcccggatctgcgcggatctgcgggattcctgtgggtggggtgagagattcggtccgcggggggatttggggtccttttagcttgttgtgtgttgagggggggggggggggggttgaggtggaatggaatggttgattcgcggcgcgaggttttgttctttggggggattgttgcaaatcgtgggaaaggtggtagccttgggttggattttttttttttggggggggggtttaatatgtagcgtttgaaagggggggcgatctgagatctgcgaatccgggtggagaagaaagaggatgtgctgtgctgtgctgtgatagatccattgtccggtctttcaactcttttagctaccatatagtttatatgatatacaggttgaatccgctggtcagcttttttttttttggggggggggggaatcagataataatcaatcatgcatctgattttagatttaatgctttctgctcacggttttcaatattagaggggttatatctgtagagagtttaggccttagggttcttatggcatacagttcacatgagtcactgtttgtttttagacagctcgaagttctaaacaacacatttaggctttattaatccatgtatcggccaatacgggcaagcacggccgtttattagcatgatgtacttgctggtgtgctctggaacgtgtggctgcctgcgttgctaccaagcatgtacatttgcatgctggtgtgcgctgctaaaaggttggacatgcttatgttgctgcctgtcatagtatacttgttgccatgcattctcagaagtgcgcatgtctgttttgctgccttgctgggttgtttatgttgcagtgttgggatcatagctgctgtctgcatgtgtcccactctgtttaagcttatgattcttcctttggttacactcatcagtgaaattgtggtccttattatgcattctcttttattttgatggcagaaacatcgtatcgacggtcaatttggattgcaaattagacctcaaagctatagctttgcaagctcgcaatgcagaatataatccaaaggtattatgatggcttcggtgtgttctagtgtctctgttttggctcaaaaggatatcttcattgcatgttaaaatgataccaatgttattcttagtagcatgtaatatgtagacaaggtccatatattcctatggtctgttcctagagtgatatttcctttgtgtataacataagtgttagtgcaattttagatgtcagtatggataaatccatagttgacagtcgagttttgtaaggcaagtctcagttaagatagtgaagacagcttgtcccacagataaacaaattgctctacaaataagattataaaaattactctttttagtgctttgggctttttatctgtgctgcatgtaccagacgcagcacgaggtattgggagattttgtaactatatgtaatatcgtaagctaaatctaggtgtaccatgtttgctttaataataaatacattttggaaggaacagacatagcgcacactggggttataaacatctctatctagtatcttagattgatttacactatgtcagtggcgcactatataatttcatactcatttgctgtaatttatgttttagtttgctaattcctcctttcataaacagcgttttgctgcggttatcatgagaataagagaaccaaaaactacagctctgatatttgcatcgggtaaaatggtatggttcaacttcttgtaccgtgactgcaaatgttctgttttgttcatctgcttattgacttgtgaattgttttgttatctgtccaatggccagctgttgatcttgtagctattataatgcatattgattcatgaactgtttttgctgctgtgtaactgcttttgctattagcatactatctttttagtttttatttacttgttaacagctatcacatccctacctttatccgtgccgcattgcagcctgtatttcaatgttgaatctgtgaatttacttttgctctgatttttctgacatgtttgctgttgcattggtgtgtcaatagctatcacatccatatctgatccaagcagcctgtagttcaatgttgaatctgtaaatttaattttgctctgagtttatgaaatgtttgctgttgcattgctgtgtcatatagtaataactgcatgagtattgttctttctgtgaatgtatagtttgtccttgttaacttttttatggctttaaagcataataggaattgtttattcacaataaattgaacctaacatatttatttgttgaaggataatcagcaatagcacatcacatgcttcctgtctggtcaatatcttcatttttcttgaaaatcacttgaattttcttttggttcaatatctccatccaaataactttacctgttgaagccttaggcttactagtatgtcgtatggggcctgtctgttaggcagtgaacttaaagaaagggttgccatgggtttgacgcaccaatttgttgcatcttttcttctcttttttcctttgtataaaaaaaacaaatatggctgttaaccaaaatttctcagtgtccaccgtgatgtctggcatctatggttaaattagaggtctgtttataaatcttttgtgtcctataccaggtctgtactggggcaaagagtgaacaacaatccaagcttgcagcaagaaaggtatgagcggtagtttttattttattttgctatatctgtctctctgaagtcttaacactagtttttatcaccagtacgctcgtattatccagaagcttggctttcctgctaaattcaaggtaactatttcaagcttgcttgattttcatctgtgcatgtgcctaccaaatacattctgtaattgtacctaactgtttaactcattgcactataccaggatttcaagattcagaacattgttggctcttgtgatgttaaatttccaatcaggctggagggacttgcatattctcatggtgctttctcaagtgtaagttgagtccttgcatgcctttttaggacgcctttcacatttgttatgttgttcttatgtcctgtgccttttgtgttaacagtatgagccagaactctttcctggtctgatatatcggatgaagcaaccaaagattgttcttctgatttttgtttcaggcaagattgttttgaccggagcaaaggttagcagcctttccttttgtatattcttgattgcctattcctttttgtatgtctgaatatactgtctttataggtgagggatgagacgtataccgcctttgagaacatataccctgtgctaacggagttcagaaaagtccagcagtggtatgtctttattttgttatttaagtatgcagtgtgctgtacaaatatcggaacaatacatgaagtaggaatgatagtggataattgcaacttatctgtcttttgttatattatatatgtgagtggaccatgggcatatactaaattgcaatatgttgcatcttttaatattgttactggtctatggttgtaaactatcctttgtagtgtaagcacctaataaatctaaactttccaattagaatccagatggtttagcagaaactgaaggcacaatttatctcaagaaaaagattttaatttaccactaccttgatcttagacaggatatactgatggttttagatgccatgaagcaataccgcgtgatatactgatggtttcttgctccttccaatttgcagaaaacttatggaatacacaagtacaagcttccttgagattttgctgcctagtgactgctaatcttaactgtacatatggtctggaggagcgtatagcatcttgtaatttatgtgagcccctcgatgcacgagtgttgtagacttgttgtagtaggcttgtagcttgggtgactgagagacttgagtatcgcgttcagtcgaacgaggtggagacgtggagttatcgtactttagcccgtgctgatttttttcccttcacaaatagatctgtagcgaaacattttattacagaaatgggcggctaacttttaacaaacagaacatatgtactgtggatgcgttgcgttttacagtagaatgtcatggactgtttggatggtgg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057347.1 RefSeq:Os03g0657000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 05:57, 12 June 2015

Please input one-sentence summary here.

Annotated Information

Function

TBP is a subunit of the eukaryotic transcription factor TFIID. TFIID is the first protein to bind to DNA during the formation of the pre-initiation transcription complex of RNA polymerase II (RNA Pol II). Binding of TFIID to the TATA box in the promoter region of the gene initiates the recruitment of other factors required for RNA Pol II to begin transcription. Some of the other recruited transcription factors include TFIIA, TFIIB, and TFIIF. Each of these transcription factors is formed from the interaction of many protein subunits, indicating that transcription is a heavily regulated process.

TBP is also a necessary component of RNA polymerase I and RNA polymerase III, and is, it is thought, the only common subunit required by all three of the RNA polymerases.

When TBP binds to a TATA box within the DNA, it distorts the DNA by inserting amino acid side-chains between base pairs, partially unwinding the helix, and doubly kinking it. The distortion is accomplished through a great amount of surface contact between the protein and DNA. TBP binds with the negatively charged phosphates in the DNA backbone through positively charged lysine and arginine amino acid residues. The sharp bend in the DNA is produced through projection of four bulky phenylalanine residues into the minor groove. As the DNA bends, its contact with TBP increases, thus enhancing the DNA-protein interaction.

The strain imposed on the DNA through this interaction initiates melting, or separation, of the strands. Because this region of DNA is rich in adenine and thymine residues, which base-pair through only two hydrogen bonds, the DNA strands are more easily separated. Separation of the two strands exposes the bases and allows RNA polymerase II to begin transcription of the gene.

TBP's C-terminus composes of a helicoidal shape that (incompletely) complements the T-A-T-A region of DNA. It is interesting to note that this incompleteness allows DNA to be passively bent on binding.

The TATA-box binding protein (TBP) is required for the initiation of transcription by RNA polymerases I, II and III, from promoters with or without a TATA box. TBP associates with a host of factors, including the general transcription factors TFIIA, -B, -D, -E, and -H, to form huge multi-subunit pre-initiation complexes on the core promoter. Through its association with different transcription factors, TBP can initiate transcription from different RNA polymerases. There are several related TBPs, including TBP-like (TBPL) proteins.

Expression

The TATA-binding protein (TBP) is a general transcription factor that binds specifically to a DNA sequence called the TATA box. This DNA sequence is found about 30 base pairs upstream of the transcription start site in some eukaryotic gene promoters. TBP, along with a variety of TBP-associated factors, make up the TFIID, a general transcription factor that in turn makes up part of the RNA polymerase II preinitiation complex. As one of the few proteins in the preinitiation complex that binds DNA in a sequence-specific manner, it helps position RNA polymerase II over the transcription start site of the gene. However, it is estimated that only 10-20% of human promoters have TATA boxes. Therefore, TBP is probably not the only protein involved in positioning RNA polymerase II.

TBP is involved in DNA melting (double strand separation) by bending the DNA by 80° (the AT-rich sequence to which it binds facilitates easy melting). The TBP is an unusual protein in that it binds the minor groove using a β sheet.

Another distinctive feature of TBP is a long string of glutamines in the N-terminus of the protein. This region modulates the DNA binding activity of the C-terminus, and modulation of DNA-binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information