Difference between revisions of "Os04g0409600"

From RiceWiki
Jump to: navigation, search
(Function)
 
(93 intermediate revisions by 4 users not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions[1].
+
*Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions <ref name="ref1" />.''
  
OsSRT1 is one of the two SIR2-related genes found in rice[2].
+
*OsSRT1 is one of the two SIR2-related genes found in rice<ref name="ref2" />.''
  
Phenotypic and molecular analysis of RNA interference (RNAi) transgenic plants suggests that OsSRT1 is involved in H3K9 (Lys-9 of H3) deacetylation required for transcriptional repression of transposable elements and apoptosis-related genes. Our data suggest that OsSRT1 may have a function in the safeguard against genome instability andDNAdamage to ensure plant cell growth[1].
+
*Phenotypic and molecular analysis of RNA interference (RNAi) transgenic plants suggests that OsSRT1 is involved in H3K9 (Lys-9 of H3) deacetylation required for transcriptional repression of transposable elements and apoptosis-related genes. Our data suggest that OsSRT1 may have a function in the safeguard against genome instability andDNAdamage to ensure plant cell growth<ref name="ref1" />.''
  
[[File:Figure_1.OsSRT1_RNAi_induced_a_lesion_mimic_phenotype.jpg|right|thumb|150px|Figure_1.OsSRT1_RNAi_induced_a_lesion_mimic_phenotype]]
+
[[File:Figure_1.OsSRT1_RNAi_induced_a_lesion_mimic_phenotype.jpg|right|thumb|360px|Figure_1.OsSRT1_RNAi_induced_a_lesion_mimic_phenotype.''<ref name="ref1" />'']]
  
  
OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1[1].
+
*OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1<ref name="ref1" />.''
  
OsSRT1 is a histone acetylation enzyme, participating in  acetylation of H3K9, inhibition of transposon and gene expression related to cell apoptosis. Rice SIR2 gene is important to maintain genomic stability and avoid DNA damage in the process of plant cell growth. OsSRT1 is involved in the safeguard against genome instability and/or oxidative stress, required for plant cell growth[2].
+
 
 +
*OsSRT1 is a histone acetylation enzyme, participating in  acetylation of H3K9, inhibition of transposon and gene expression related to cell apoptosis. Rice SIR2 gene is important to maintain genomic stability and avoid DNA damage in the process of plant cell growth. OsSRT1 is involved in the safeguard against genome instability and/or oxidative stress, required for plant cell growth<ref name="ref2" />.''
 +
 
 +
 
 +
*Histone lysine acetylation is an important epigenetic modification for genome function and gene activity. Dynamic modulation of histone acetylation in plants has been shown to be involved in gene expression programs of plant development and responses to environmental conditions <ref name="ref13" />.''<ref name="ref14" />.''
 +
 
 +
 
 +
*The homeostasis of histone H3K9 acetylation regulated by OsSRT1 in controlling genome-wide gene expression remained unclear. It was not known whether OsSRT1 directly targeted to specific genes to undergo histone deacetylation. To study the chromatin function and to identify direct binding targets of the OsSRT1, we first compared the genome-wide H3K9 acetylation profiles between wild type and OsSRT1 down-regulation plants, and then investigated the genomic binding sites of OsSRT1 by chromatin immunoprecipitation assays.OsSRT1 down-regulation did not drastically alter the genome-wide H3K9ac landscape, but led to increases of H3K9ac over a subset of genes belonging to specific functional categories and transposable elements. OsSRT1 was found to be associated with 1824 genes that showed relatively low levels of H3K9ac. <ref name="ref16" />.''
  
 
===Expression===
 
===Expression===
OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues[1].  
+
*OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues<ref name="ref1" />.''
 +
 
 +
 
 +
*Our data show that OsSRT1 was preferentially expressed in rapidly dividing young tissues/organs and the protein was nuclear localized. Phenotypic and molecular analysis of RNA interference (RNAi) transgenic plants suggests that OsSRT1 is involved in H3K9 (Lys-9 of H3) deacetylation required for transcriptional repression of transposable elements and apoptosis-related genes. Our data suggest that OsSRT1 may have a function in the safeguard against genome instability andDNAdamage to ensure plant cell growth<ref name="ref1" />.''
 +
 
 +
 
 +
[[File:Figure_2.OsSRT1_RNAi_induced_H2O2_production_and_genomic_DNA_fragmentation.jpg|right|thumb|360px|Figure_2.OsSRT1_RNAi_induced_H2O2_production_and_genomic_DNA_
 +
fragmentation.''<ref name="ref3" />'']]
 +
 
 +
*OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress<ref name="ref3" />.''
 +
 
 +
 
 +
*So far no physiological function has been assigned to plant Sir2-related proteins. As there are fewer SIR2-related genes found in plant genomes, important questions arise, such as whether plant Sir2-related proteins conserve similar functions as yeast and animal homologs. In this work, we studied the function of a rice (Oryza sativa) SIR2-like gene,by transgenic approaches OsSRT1 <ref name="ref5" />.''
 +
 
 +
 
 +
 
 +
*As H3K9 dimethylation is closely associated with H3K9 deacetylation <ref name="ref8" />.''  we also tested with antibodies against dimethylated H3K9. As shown in Figure 3C, the OsSRT1 RNAi had little effect on overall histone H3 acetylation. However, the acetylation of H3K9 was induced, whereas the dimethylation of H3K9 was reduced, in agreement with the antagonistic relationship between H3K9 acetylation<ref name="ref1" />.''
 +
 
 +
 
 +
*The RNAi lines were selected for phenotype observation and further analysis. The RNAi plants at the two-leaf stage (about 14 d after germination) began to produce brown dots on leaves, which became larger at latter stages, leading to precocious leaf senescence. Only two of the three RNAi lines could produce seeds. The severest line died before getting into maturity. The transgenic lines showing no alteration of OsSRT1 expression or histonemodification did notmanifest the phenotype, suggesting that the lesion mimic phenotype was induced by OsSRT1 down-regulation. The lesions were reminiscent of cell death induced by hypersensitive responses during plant pathogen infections, suggesting that OsSRT1 RNAi might have induced programmed cell death (PCD). To test this hypothesis, young leaf sheaths (T1 generation) were incubated with 3,3#-diaminobenzidine (DAB) to detect H2O2 <ref name="ref12" />.''
 +
 
 +
 
 +
[[File:Figure 3. Overexpression of OsSRT1 conferred tolerance to paraquat treatment.jpg|right|thumb|360px|Figure 3. Overexpression of OsSRT1 conferred tolerance to paraquat treatment. ''<ref name="ref3" />'']]
 +
 
 +
*OsSRT1 was generally expressed in different tested rice tissues, but with higher transcript levels detected in tissues with high cell proliferation rates, such as buds, seedlings, and developing panicles HSR201 and APO, but not HSR203J, were found to be induced by OsSRT1 RNAi in the microarray data. Consistently, the RT-PCR results showed that HSR201 and APO, but not HSR203J, were activated early in 7-d-old RNAi plants. In contrast, HSR203J was repressed by OsSRT1 overexpression.<ref name="ref1" />.''
 +
 
 +
 
 +
*We compared the expression of two hypersensitive response (HSR201 and HSR203J) marker genes <ref name="ref9" />.''and a cytochromeP450 gene (calledAPO) that is closely related to wheat (Triticum aestivum) CYP709C1 and CYP709C3v2, both of which are suggested to be involved in wheat defense to pathogens <ref name="ref10" />.''<ref name="ref11" />.''
 +
 
 +
 
 +
*Down-regulation of OsSRT1 by RNAi produces a lesion-mimic phenotype and induces H3K9 acetylation (H3K9ac) and expression of hypersensitive response-related genes in rice plants. In addition, the transcription of many transposable elements is activated in the RNAi plants, indicating that transposons and cell death-related genes might be among the primary targets of OsSRT1-mediated gene silencing.<ref name="ref15" />.''
 +
 
 +
 
  
OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress[3].
+
[[File:Figure 4. Expression profiles of OsSRT1.jpg|right|thumb|360px|Figure 4. Expression profiles of OsSRT1.''<ref name="ref1" />'']]
  
OsSRT1 was generally expressed in different tested rice tissues, but with higher transcript levels detected in tissues with high cell proliferation rates, such as buds, seedlings, and developing panicles[1].
+
 
 +
*Histone acetylation is catalyzed by histone acetyltransferases, whereas histone deacetylation is catalyzed by histone deacetylases (HDACs). Plant HDACs can be grouped into four subclasses. Three of them have primary homology to the three classes of HDACs (RDP3, HDA1, and SIR2) found in yeast and animal cells <ref name="ref5" />.'' The fourth class of plant HDACs (known as the HD2 class) is found only in plants <ref name="ref5" />.'' <ref name="ref6" />.''
  
 
===Evolution===
 
===Evolution===
Sir2 family proteins, known also as sirtuins, are NAD1-dependent protein deacetylases. They contain a 200-amino acid domain conserved from bacteria to humans[4].
+
*Sir2 family proteins, known also as sirtuins, are NAD1-dependent protein deacetylases. They contain a 200-amino acid domain conserved from bacteria to humans<ref name="ref5" />.
  
Yeast has four additional Sir2 homologs, termedHst1 to Hst4, Plant genomes seem to contain relatively fewer SIR2 homologs than the other eukaryotes[4].
+
*Yeast has four additional Sir2 homologs, termedHst1 to Hst4, Plant genomes seem to contain relatively fewer SIR2 homologs than the other eukaryotes<ref name="ref6" />.''
  
Compared to other eukaryotes, plants have relatively fewer SIR2-related genes Plant predicted SRT1 proteins showed relatively high conservation. Only the N-terminal parts of the plant proteins were conserved with the animal homologs[5].
+
*Sequence analysis of the rice genome revealed two SIR2-related genes, named OsSRT1 andOsSRT2.OsSRT1 and other plant SRT1 homologs are found in the same class (class IV), whereas OsSRT2 belongs to class II of the SIR2-related genes<ref name="ref5" />.''
 +
 
 +
*Compared to other eukaryotes, plants have relatively fewer SIR2-related genes Plant predicted SRT1 proteins showed relatively high conservation. Only the N-terminal parts of the plant proteins were conserved with the animal homologs<ref name="ref5" />.''
 +
 
 +
*Yeast has four additional Sir2 homologs, termedHst1 to Hst4, in addition to the founding member. All of the yeast members belong to class I of the Sir2-related proteins.Mammalian cells have seven members of the SIR2 family (SIRT1–SIRT7), distributed into all four classes <ref name="ref4" />.''Three of the mammalian members are localized in the nucleus; the remaining members are either cytoplasmic or mitochondrial localized <ref name="ref7" />.''
  
 
==Labs working on this gene==
 
==Labs working on this gene==
National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University,Wuhan 430070, China
+
*National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University,Wuhan 430070, China
 +
 
 +
*Department of Quartermaster, Military Economy Academy, Wuhan 430035, China
 +
 
 +
*Institut de Biotechnologiedes Plantes, Universite´ Paris Sud 11, 91405 Orsay, France
 +
==References==
 +
<references>
 +
 
 +
<ref name="ref1" > Limin Huang2, Qianwen Sun2, Fujun Qin, Chen Li, Yu Zhao, and Dao-Xiu Zhou* Down-Regulation of a SILENT INFORMATION REGULATOR2-Related Histone Deacetylase Gene, OsSRT1, Induces DNA Fragmentation and Cell Death in Rice. Plant Physiol. Vol. 144, 2007</ref>
 +
 
 +
<ref name="ref2" > Blander G, Guarente L (2004) The Sir2 family of protein deacetylases.Annu Rev Biochem 73: 417–435</ref>
 +
 
 +
<ref name="ref3" > Thordal-Christensen H, Zhang Z, Wei Y, Collinge DB (1997) Subcellular localization of H2O2in plants. H2O2accumulation in papillae and hypersensitive response during the barley powdery mildew interaction. Plant J 11: 1187–1194</ref>
 +
 
 +
<ref name="ref4" > Frye RA (2000) Phylogenetic classification of prokaryotic and eukaryotic Sir2-like proteins. Biochem Biophys Res Commun 273: 793–798</ref>
 +
 
 +
<ref name="ref5" > PandeyR,Muller A, NapoliCA,Selinger DA,PikaardCS,Richards EJ,Bender J, Mount DW, Jorgensen RA (2002) Analysis of histone acetyltransferase and histone deacetylase families of Arabidopsis thaliana suggests functional diversification of chromatin modification among multicellular eukaryotes.</ref>
  
Department of Quartermaster, Military Economy Academy, Wuhan 430035, China
+
<ref name="ref6" > Lusser A, Brosch G, Loidl A, Haas H, Loidl P (1997) Identification of maize histone deacetylase HD2 as an acidic nucleolar phosphoprotein. Science 277: 88–91</ref>
  
Institut de Biotechnologiedes Plantes, Universite´ Paris Sud 11, 91405 Orsay, France
+
<ref name="ref7" > Haigis MC, Guarente LP (2006) Mammalian sirtuins—emerging roles in physiology, aging, and calorie restriction. Genes Dev 20: 2913–2921</ref>
  
==References==
+
<ref name="ref8" > Strahl BD, Allis CD (2000) The language of covalent histone modifications. Nature 403: 41–45</ref>
[1]Limin Huang2, Qianwen Sun2, Fujun Qin, Chen Li, Yu Zhao, and Dao-Xiu Zhou* Down-Regulation of a SILENT INFORMATION REGULATOR2-Related Histone Deacetylase Gene, OsSRT1, Induces DNA Fragmentation and Cell Death in Rice. Plant Physiol. Vol. 144, 2007
+
 
 +
<ref name="ref9" > Chu Z, Yuan M, Yao J, Ge X, Yuan B, Xu C, Li X, Fu B, Li Z, Bennetzen JL,et al (2006) Promoter mutations of an essential gene for pollen development result in disease resistance in rice. Genes Dev 20: 1250–1255</ref>
 +
 
 +
<ref name="ref10"> Kandel S, Morant M, Benvenist I, Ble´e E, Werck-Reichhart D, Pinot F(2005) Cloning, functional expression, and characterization of CYP709C1, the first sub-terminal hydroxylase of long chain fatty acid in plants. J Biol Chem 280: 35881–35889</ref>
 +
 
 +
<ref name="ref11"> Kong L, Anderson JM, OhmHW(2005) Induction of wheat defense and stressrelated genes in response to Fusarium graminearum. Genome 48: 29–40</ref>
 +
 
 +
<ref name="ref12"> Thordal-Christensen H, Zhang Z, Wei Y, Collinge DB (1997) Subcellular localization of H2O2 in plants. H2O2 accumulation in papillae and hypersensitive response during the barley powdery mildew interaction. Plant J 11: 1187–1194</ref>
 +
 
 +
<ref name="ref13">Servet C, Conde E, Silva N, Zhou D-X (2010) Histone acetyltransferase AtGCN5/HAG1 is a versatile regulator of developmental and inducible gene expression in Arabidopsis. Molecular plant 3: 670–677</ref>
 +
 
 +
<ref name="ref14">Chen ZJ, Tian L (2007) Roles of dynamic and reversible histone acetylation in plant development and polyploidy. Biochimica et Biophysica Acta 1769: 295–307.</ref>
  
[2]Blander G, Guarente L (2004) The Sir2 family of protein deacetylases.Annu Rev Biochem 73: 417–435
+
<ref name="ref15">Huang L, Sun Q, Qin F, Li C, Zhao Y, et al. (2007) Down-regulation of a SILENT INFORMATION REGULATOR2-related histone deacetylase gene, OsSRT1, induces DNA fragmentation and cell death in rice. Plant Physiology 144: 1508–1519.</ref>
  
[3]Thordal-Christensen H, Zhang Z, Wei Y, Collinge DB (1997) Subcellular localization of H2O2in plants. H2O2accumulation in papillae and hypersensitive response during the barley powdery mildew interaction. Plant J 11: 1187–1194
+
<ref name="ref16">Hu Y, Liu D, Zhong X, Zhang C, Zhang Q, et al. (2012) CHD3 protein recognizes and regulates methylated histone H3 lysines 4 and 27 over a subset of targets in the rice genome. Proceedings of the National Academy of Sciences of the United States of America 109: 5773–5778.</ref>
  
[4]Frye RA (2000) Phylogenetic classification of prokaryotic and eukaryotic Sir2-like proteins. Biochem Biophys Res Commun 273: 793–798
 
  
[5] PandeyR,Muller A, NapoliCA,Selinger DA,PikaardCS,Richards EJ,Bender J, Mount DW, Jorgensen RA (2002) Analysis of histone acetyltransferase and histone deacetylase families of Arabidopsis thaliana suggests functional diversification of chromatin modification among multicellular eukaryotes.
+
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0409600|
 
Description = Similar to Histone deacetylase|
 
Version = NM_001059260.1 GI:115458249 GeneID:4335765|
 
Length = 5631 bp|
 
Definition = Oryza sativa Japonica Group Os04g0409600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:20272401..20278031|
 
CDS = 20274537..20274646,20274795..20274884,20275077..20275140,20275863..20275955,20276034..20276142<br>,20276428..20276477,20276551..20276641,20276876..20276946,20277195..20277293<br>,20277457..20277523,20277723..20277808|
 
GCID = <gbrowseImage1>
 
name=NC_008397:20272401..20278031
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:20272401..20278031
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atcataaaacatgtgatattgctatcaattgggctggtggatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngagcttctcaataccatgccaggttctctatattgatatcgatgttcatcacggggatggagttgaagaagccttttatttcactgacagggtaatgactgtaagtttccacaagtatggtgattttttcttccctggcacaggtgatattaaggatataggagaaagagaaggaaaatattatgccattaacattccacttaaagatgggatagatgactccggctttactcgcctttttaaaacagttattgccaaagttgttgagacatatctgccaggtgctattgttcttcaatgcggggctgattccttggcacgggaccgtctggggtgcttcaatctgtccattgaaggccatgctgaatgtgtgaagtttgtcaagaaattcaatatccctctactggtgactgggggtggtggatacacaaaagagaatgtagcacgctgttgggctgttgaaactggtgttcttctagatacggagctcccaaatgaaattccagacaatgaatacatcaaatactttgctccagattatacattgaaagtatcgaatgtgaacatggacaacttgaatagcaagtcatatctaagttcaatcaaagtgcaagtcatggagagtttgcgggccatacaacatgcgcctggtgttcagatgcaagaggttccaccagatttttatatcccagatattgatgaagatgagctggatcctgatgaacgtgtagatcagcatacccaagacaagcagattcatcgcgatgacgagtactatgaaggtgacaacgacaatgatcatgaggacggggcccgttga</cdnaseq>|
 
AA = <aaseq>IIKHVILLSIGLVDXXXXXXXXXXXXXXXXXXXXXXXSFSIPCQ                    VLYIDIDVHHGDGVEEAFYFTDRVMTVSFHKYGDFFFPGTGDIKDIGEREGKYYAINI                    PLKDGIDDSGFTRLFKTVIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAEC                    VKFVKKFNIPLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYT                    LKVSNVNMDNLNSKSYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYIPDIDEDELDP                    DERVDQHTQDKQIHRDDEYYEGDNDNDHEDGAR</aaseq>|
 
DNA = <dnaseqindica>2137..2246#2395..2484#2677..2740#3463..3555#3634..3742#4028..4077#4151..4241#4476..4546#4795..4893#5057..5123#5323..5408#cggtgcctttctacagcggcgttccactcgggttggtctctcccccgaggcacggccgccgccgccgccgcgctcggtctaatcggaatctatttctcgacgcgactccgcttccccggctcccctctcacccttccgcgccgccgccgccgccgcttgtagtggttggggggcgagcggccgctcgagagcgaagcgatgctggagaaagacaggatagcctacttctacgatggtacgaccgcgcattcgctaagcccccctcatctcctctccattctccctaatcactggagcaaccctagctctagctctagatgatagagcgaaatcctacgccgtctcgatgttgtgtggcttaatttcgtcgaagaaggggcatgcaattagtacctaagctgatttctagtggtgttatatgattgtggaggttggagtggatgttacggttggacggcttatgagaaattccagaactatgaacttcccaggacttgttcaactaggatttgtggtatttcagttgccctagccctaggtgcatgacgcatgattcattatcagtcagtaacataaggtggggaagcaacccttgaatcaagatttgaattagaatcgttgatccctttatctgtttaagagggcgcagtcaggctagatttggttaacaagttcctatattctttagcgccagccattttctaaaaggtcaccaacgccagccatatgtggttatttcttagatcacacataaatttccatgataagttctctcacatattttgtactaggtggtttcatgacttgtgccctcattcacccatggtcctttacatctctgtttatagagagccactcattttgcagatgtgaaaggaagttttcattgttcaaaatgtgtaatttttattactcattttgttttgatcgtttacctttttactgtgtcaatgaacaattcaggcgatgtgggcaatgtctactttgggccaaatcacccgatgaaaccacatcgactttgtatgacacatcatcttgtgctttcatatgatcttcacaagaagatggagatatatgtcagtatgaactttatttattcccttcgtttgcacttgttaactgcctaaagttcctttcacctcttacttttcacacaacgatttatgcagaggccccacaaagcatatccaacagagctcgcacagttccattctgctgattatgtggaattcttgcatcggataactcctgacacccaacacctgtatgaaaatgaattacgtagatgtatgaattatgaaacttttctcctctatgaactagtactctgggatttgttaattttacaataaaatggttgtcacatatcttgctactcatgtttaaattattataaatttatttattaagttccttacctggatctaataagtagcttagatcttcatgtacagttaaactataaggaatctcatacacaacttaaggctaattagcttcacttacatgaatgctgtcaggtgtatattcacgatatgcctatttgacaattcaaggaaaatgagggcatgtttggtcccctttcaagctcaagcaacttcccatctaacgctgcctagatagcgttggtgtttagtacagcttagcaagtcattcttcataggatgtatatccttgcccattgaagcgcatcccttgtggtcaaggtttacatgatttggtgcactaaatagttttggatatctttacagtatttatatagtattagttgcactcttctaggacacatgtgcttattttacagtttcagggcaaaataactgaacacctaacctaagtagcagagtaatctggacaaaagatccaacttacccactcttagagcttttccccaattgaagttggtttccaacataatcctcatgccttttggagctttctaacttcatttatctggttccttcatatttgttcccagacaatcttggagaagactgcccagtctttgataatctgtttgagttttgccaaatatatgctggaggaactctaggtaatatgaaaattctgaatgcttctttctaaagtgaactcttaagttcttctttgctattttagatgcggctcgcagattgaatcataaaacatgtgatattgctatcaattgggctggtggatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnatcttttttggattctgagcttctcaataccatgccaggttctctatattgatatcgatgttcatcacggggatggagttgaagaagccttttatttcactgacaggttcatgctgtttccaataaagtcatggatatgtagttaatcatttattgctgccaatatttttccaatccaatttccatctctgtgcattttgtgaattttggtggtaccataatatttatactaattccagtctcgggcttttgattttgcagggtatactaatattgtatacttattttgattttgcagggtaatgactgtaagtttccacaagtatggtgattttttcttccctggcacaggtgatattaaggtaatgttccactaacaagctcctgaatattttttatgtactttttggtatgatgtggttggtgattggcccttctctgcattctgttttatccttacccttttcgcatgaagtgtgtgtgacatgcgtactctcatttgtgtgaaaaaagaagagacagattaaccaaagatggtccccagttgattttgtaatgcacaaaattgatagcacctgtaggtaattgtttatgagcagttaatcttgtttctttttagttctacccgccaagaggctgtaaatatgtaacatcatagagttgaactttggttttttttactggagattcttggcatgttattctatttaaatatcaaccattgtaattgggaattcaggtggttatgtatttgaaaaacgtcatactagaatgcatcataattcgtatacgcatgcttaattgtcatctgggctgacaaaaaaaaaacatgtgcacatatacgcccgtcatttgaatcttgtagtatgttaatttgttatgtatccactgtactactaggcaactttattaaataaaaatatcccaaataactggaaggtagagcaagtgtgctacaaaaagggcaaggttgaaaatgaacataaaacatgccatgttcttctcagtaacgatgatactttatatagcttcgttttaaatgattgtgctgcttcatattgatttacctgactctcatttgaaggatataggagaaagagaaggaaaatattatgccattaacattccacttaaagatgggatagatgactccggctttactcgcctttttaaaacagtaagcccactttacattactttctcatctttcatgtcattgtttagtcttatcaagttatgcatgtctattatgtaggttattgccaaagttgttgagacatatctgccaggtgctattgttcttcaatgcggggctgattccttggcacgggaccgtctggggtgcttcaatctgtccattgaaggttctgtacttcttaaatctgatgtgtacttgttgattcagcagaactgtgctctagatgtaaagttagtgaactgtgctgcatattcttggatgagctattagggttcaggcggtatcttcgagataatgtgaaaccttctctcaagtctcaattatttcttaccatagttttgagattgttattgcactaatagttctgacttattttgaaatttaaattttgtttctttgagctatacttagtgaatgatcttttaatacttgcatgtgtacttgcaaacaggccatgctgaatgtgtgaagtttgtcaagaaattcaatatccctctactggtaaggacaaaccgttactgcgtgtgatttctcttgttcctccttggatatcaatgtatttcccatcatgcaggtgactgggggtggtggatacacaaaagagaatgtagcacgctgttgggctgttgaaactggtgttcttctagatacggagctcccaaatggtattcttttcttttgcaattctgtacttctcggtccttttggcctgttgttttagaggacactactagtaatccctcaaatgcatgcaacagttcatgtattcttttcctcacatttgctggcatatcaagttgcaaacagatctatcaagaacgggattgactagtagagttccttaataatttctaaaacagcagtctgtgatatgagtttggcatgactttcctttgcagaaattccagacaatgaatacatcaaatactttgctccagattatacattgaaagtatcgaatgtgaacatggtatggaaccttttctcattggcctttgtttgtcctacggttgtttggtgcattgatatttgattgctattaggtgcatcaagtaactgtccttttattactgagtatggtctaagcatttgagctctgtagtccatttggtatttcggctattcaattggtttgtgtttgctagaagtttagaacttgcgttcctttcttgagaatgtgcaaatgccatatcacatgttgtgttttaaccggagcaggacaacttgaatagcaagtcatatctaagttcaatcaaagtgcaagtcatggagagtttgcgggccatacaacatgcgcctggtgttcagatgcaagaggttagtttttgattcacttacacgaggaaacctcccaactggaatttgctatgtaaaaaaaagggatacaagcaggacactataatattcctttccttttgttgcctatctttttcttcgttcaacatatttctgaacaagaacaatattaacatttttgcaggttccaccagatttttatatcccagatattgatgaagatgagctggatcctgatgaacgtgtagatcgtaagtgaaatactcctgggatgcattaggatgctaatatgtctgggtgtctgctgttccaagaaaacgaacggcagacagttgttttttttagtatatgttgtgtgttccacattatgctagtcctttcttcgtgttgttttcagacctttgaactttatatcgtccttatacattaactgtgtaaaatgttgcgcagagcatacccaagacaagcagattcatcgcgatgacgagtactatgaaggtgacaacgacaatgatcatgaggacggggcccgttgaaaaaggttctttgtatgatgaaactggatagagaaagtctggtgctgttgcgcggtttaacagcgttaggtgggaaatactgtcaattgacttgttaggatctaacacctttgcctgcatatagtgcgtgtacgttcctactttttaatcagttacatatgctagttgcatgcagagattgcaaattcttagtcggtggtaatgattcatagtttttggctgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059260.1 RefSeq:Os04g0409600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:03, 12 June 2015

OsSRT1 is one of the two SIR2-related genes found in rice.

Annotated Information

Function

  • Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions [1].
  • OsSRT1 is one of the two SIR2-related genes found in rice[2].
  • Phenotypic and molecular analysis of RNA interference (RNAi) transgenic plants suggests that OsSRT1 is involved in H3K9 (Lys-9 of H3) deacetylation required for transcriptional repression of transposable elements and apoptosis-related genes. Our data suggest that OsSRT1 may have a function in the safeguard against genome instability andDNAdamage to ensure plant cell growth[1].
Figure_1.OsSRT1_RNAi_induced_a_lesion_mimic_phenotype.[1]


  • OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1[1].


  • OsSRT1 is a histone acetylation enzyme, participating in acetylation of H3K9, inhibition of transposon and gene expression related to cell apoptosis. Rice SIR2 gene is important to maintain genomic stability and avoid DNA damage in the process of plant cell growth. OsSRT1 is involved in the safeguard against genome instability and/or oxidative stress, required for plant cell growth[2].


  • Histone lysine acetylation is an important epigenetic modification for genome function and gene activity. Dynamic modulation of histone acetylation in plants has been shown to be involved in gene expression programs of plant development and responses to environmental conditions [3].[4].


  • The homeostasis of histone H3K9 acetylation regulated by OsSRT1 in controlling genome-wide gene expression remained unclear. It was not known whether OsSRT1 directly targeted to specific genes to undergo histone deacetylation. To study the chromatin function and to identify direct binding targets of the OsSRT1, we first compared the genome-wide H3K9 acetylation profiles between wild type and OsSRT1 down-regulation plants, and then investigated the genomic binding sites of OsSRT1 by chromatin immunoprecipitation assays.OsSRT1 down-regulation did not drastically alter the genome-wide H3K9ac landscape, but led to increases of H3K9ac over a subset of genes belonging to specific functional categories and transposable elements. OsSRT1 was found to be associated with 1824 genes that showed relatively low levels of H3K9ac. [5].

Expression

  • OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues[1].


  • Our data show that OsSRT1 was preferentially expressed in rapidly dividing young tissues/organs and the protein was nuclear localized. Phenotypic and molecular analysis of RNA interference (RNAi) transgenic plants suggests that OsSRT1 is involved in H3K9 (Lys-9 of H3) deacetylation required for transcriptional repression of transposable elements and apoptosis-related genes. Our data suggest that OsSRT1 may have a function in the safeguard against genome instability andDNAdamage to ensure plant cell growth[1].


Figure_2.OsSRT1_RNAi_induced_H2O2_production_and_genomic_DNA_ fragmentation.[6]
  • OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress[6].


  • So far no physiological function has been assigned to plant Sir2-related proteins. As there are fewer SIR2-related genes found in plant genomes, important questions arise, such as whether plant Sir2-related proteins conserve similar functions as yeast and animal homologs. In this work, we studied the function of a rice (Oryza sativa) SIR2-like gene,by transgenic approaches OsSRT1 [7].


  • As H3K9 dimethylation is closely associated with H3K9 deacetylation [8]. we also tested with antibodies against dimethylated H3K9. As shown in Figure 3C, the OsSRT1 RNAi had little effect on overall histone H3 acetylation. However, the acetylation of H3K9 was induced, whereas the dimethylation of H3K9 was reduced, in agreement with the antagonistic relationship between H3K9 acetylation[1].


  • The RNAi lines were selected for phenotype observation and further analysis. The RNAi plants at the two-leaf stage (about 14 d after germination) began to produce brown dots on leaves, which became larger at latter stages, leading to precocious leaf senescence. Only two of the three RNAi lines could produce seeds. The severest line died before getting into maturity. The transgenic lines showing no alteration of OsSRT1 expression or histonemodification did notmanifest the phenotype, suggesting that the lesion mimic phenotype was induced by OsSRT1 down-regulation. The lesions were reminiscent of cell death induced by hypersensitive responses during plant pathogen infections, suggesting that OsSRT1 RNAi might have induced programmed cell death (PCD). To test this hypothesis, young leaf sheaths (T1 generation) were incubated with 3,3#-diaminobenzidine (DAB) to detect H2O2 [9].


Figure 3. Overexpression of OsSRT1 conferred tolerance to paraquat treatment. [6]
  • OsSRT1 was generally expressed in different tested rice tissues, but with higher transcript levels detected in tissues with high cell proliferation rates, such as buds, seedlings, and developing panicles HSR201 and APO, but not HSR203J, were found to be induced by OsSRT1 RNAi in the microarray data. Consistently, the RT-PCR results showed that HSR201 and APO, but not HSR203J, were activated early in 7-d-old RNAi plants. In contrast, HSR203J was repressed by OsSRT1 overexpression.[1].


  • We compared the expression of two hypersensitive response (HSR201 and HSR203J) marker genes [10].and a cytochromeP450 gene (calledAPO) that is closely related to wheat (Triticum aestivum) CYP709C1 and CYP709C3v2, both of which are suggested to be involved in wheat defense to pathogens [11].[12].


  • Down-regulation of OsSRT1 by RNAi produces a lesion-mimic phenotype and induces H3K9 acetylation (H3K9ac) and expression of hypersensitive response-related genes in rice plants. In addition, the transcription of many transposable elements is activated in the RNAi plants, indicating that transposons and cell death-related genes might be among the primary targets of OsSRT1-mediated gene silencing.[13].


Figure 4. Expression profiles of OsSRT1.[1]


  • Histone acetylation is catalyzed by histone acetyltransferases, whereas histone deacetylation is catalyzed by histone deacetylases (HDACs). Plant HDACs can be grouped into four subclasses. Three of them have primary homology to the three classes of HDACs (RDP3, HDA1, and SIR2) found in yeast and animal cells [7]. The fourth class of plant HDACs (known as the HD2 class) is found only in plants [7]. [14].

Evolution

  • Sir2 family proteins, known also as sirtuins, are NAD1-dependent protein deacetylases. They contain a 200-amino acid domain conserved from bacteria to humans[7].
  • Yeast has four additional Sir2 homologs, termedHst1 to Hst4, Plant genomes seem to contain relatively fewer SIR2 homologs than the other eukaryotes[14].
  • Sequence analysis of the rice genome revealed two SIR2-related genes, named OsSRT1 andOsSRT2.OsSRT1 and other plant SRT1 homologs are found in the same class (class IV), whereas OsSRT2 belongs to class II of the SIR2-related genes[7].
  • Compared to other eukaryotes, plants have relatively fewer SIR2-related genes Plant predicted SRT1 proteins showed relatively high conservation. Only the N-terminal parts of the plant proteins were conserved with the animal homologs[7].
  • Yeast has four additional Sir2 homologs, termedHst1 to Hst4, in addition to the founding member. All of the yeast members belong to class I of the Sir2-related proteins.Mammalian cells have seven members of the SIR2 family (SIRT1–SIRT7), distributed into all four classes [15].Three of the mammalian members are localized in the nucleus; the remaining members are either cytoplasmic or mitochondrial localized [16].

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University,Wuhan 430070, China
  • Department of Quartermaster, Military Economy Academy, Wuhan 430035, China
  • Institut de Biotechnologiedes Plantes, Universite´ Paris Sud 11, 91405 Orsay, France

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Limin Huang2, Qianwen Sun2, Fujun Qin, Chen Li, Yu Zhao, and Dao-Xiu Zhou* Down-Regulation of a SILENT INFORMATION REGULATOR2-Related Histone Deacetylase Gene, OsSRT1, Induces DNA Fragmentation and Cell Death in Rice. Plant Physiol. Vol. 144, 2007
  2. 2.0 2.1 Blander G, Guarente L (2004) The Sir2 family of protein deacetylases.Annu Rev Biochem 73: 417–435
  3. Servet C, Conde E, Silva N, Zhou D-X (2010) Histone acetyltransferase AtGCN5/HAG1 is a versatile regulator of developmental and inducible gene expression in Arabidopsis. Molecular plant 3: 670–677
  4. Chen ZJ, Tian L (2007) Roles of dynamic and reversible histone acetylation in plant development and polyploidy. Biochimica et Biophysica Acta 1769: 295–307.
  5. Hu Y, Liu D, Zhong X, Zhang C, Zhang Q, et al. (2012) CHD3 protein recognizes and regulates methylated histone H3 lysines 4 and 27 over a subset of targets in the rice genome. Proceedings of the National Academy of Sciences of the United States of America 109: 5773–5778.
  6. 6.0 6.1 6.2 Thordal-Christensen H, Zhang Z, Wei Y, Collinge DB (1997) Subcellular localization of H2O2in plants. H2O2accumulation in papillae and hypersensitive response during the barley powdery mildew interaction. Plant J 11: 1187–1194
  7. 7.0 7.1 7.2 7.3 7.4 7.5 PandeyR,Muller A, NapoliCA,Selinger DA,PikaardCS,Richards EJ,Bender J, Mount DW, Jorgensen RA (2002) Analysis of histone acetyltransferase and histone deacetylase families of Arabidopsis thaliana suggests functional diversification of chromatin modification among multicellular eukaryotes.
  8. Strahl BD, Allis CD (2000) The language of covalent histone modifications. Nature 403: 41–45
  9. Thordal-Christensen H, Zhang Z, Wei Y, Collinge DB (1997) Subcellular localization of H2O2 in plants. H2O2 accumulation in papillae and hypersensitive response during the barley powdery mildew interaction. Plant J 11: 1187–1194
  10. Chu Z, Yuan M, Yao J, Ge X, Yuan B, Xu C, Li X, Fu B, Li Z, Bennetzen JL,et al (2006) Promoter mutations of an essential gene for pollen development result in disease resistance in rice. Genes Dev 20: 1250–1255
  11. Kandel S, Morant M, Benvenist I, Ble´e E, Werck-Reichhart D, Pinot F(2005) Cloning, functional expression, and characterization of CYP709C1, the first sub-terminal hydroxylase of long chain fatty acid in plants. J Biol Chem 280: 35881–35889
  12. Kong L, Anderson JM, OhmHW(2005) Induction of wheat defense and stressrelated genes in response to Fusarium graminearum. Genome 48: 29–40
  13. Huang L, Sun Q, Qin F, Li C, Zhao Y, et al. (2007) Down-regulation of a SILENT INFORMATION REGULATOR2-related histone deacetylase gene, OsSRT1, induces DNA fragmentation and cell death in rice. Plant Physiology 144: 1508–1519.
  14. 14.0 14.1 Lusser A, Brosch G, Loidl A, Haas H, Loidl P (1997) Identification of maize histone deacetylase HD2 as an acidic nucleolar phosphoprotein. Science 277: 88–91
  15. Frye RA (2000) Phylogenetic classification of prokaryotic and eukaryotic Sir2-like proteins. Biochem Biophys Res Commun 273: 793–798
  16. Haigis MC, Guarente LP (2006) Mammalian sirtuins—emerging roles in physiology, aging, and calorie restriction. Genes Dev 20: 2913–2921

Structured Information