Difference between revisions of "Os04g0448500"

From RiceWiki
Jump to: navigation, search
(Structured Information)
 
(9 intermediate revisions by one other user not shown)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Basic information===
 +
Gene name:aspartic protease/
 +
Gene symbol:OsAP37
 
===Function===
 
===Function===
Please input function information here.
+
Programmed cell death is essential for the development of multicellular organisms, yet pathways of plant programmed cell death and its regulation remain elusive. And the OsAP37 and OsAP25, which encode aspartic proteases that induce programmed cell death in both yeast and plants, is regulted directly by ETERNAL TAPETUM1. That is to say ETERNAL TAPETUM 1 promotes aspartic proteases triggering plant programmed cell death, and reveals a dynamic regulatory cascade in male reproductive development in rice.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
Performed microarray analysis of ''eat1'' at stage 9 of anther development , and observed changes in th expression of many genes. SoAP37showed a significant reduction in expression, which was further confirmed by qRT-PCR.
 +
 
 +
[[File:QQ图片20140609141245.jpg]]
 +
 
 +
Fig. 1 qRT-PCR analysis of OsAP37
 +
 
 +
 
 +
After 4-h 20mM H2O2 treatment, 82% and 71% of the yeast cells overexpressing OsAP25 and OsAP37, respectively, displayed positive signals when labelled with the mammalian caspase substrate FIFC-VAD-fmk, suggesting that OsAP25and OsAP37 share a similar function with YCA1 in promoting PCD process in yeast.
 +
 
 +
[[File:QQ图片20140609142222.jpg]]
 +
 
 +
Fig. 2 FITC-VAD-fmk staining showing caspase activities in yeast strains.
 +
 
 +
 
 +
Expressed the full-length CDS of OsAP25 or OsAP37 driven by the CAMV 35S promoter in plants. Trypan blue vital staining of tobacco leaves revealed substantially increased death of epidermal and mesophyll cells in leaves transiently expressing OsAP25 and OsAP37 compared with those expressing GFP, or OsAP25 and OsAP37 together with the aspartic protease-specific inhibitor pepstatin A.
 +
 
 +
[[File:QQ图片20140609142833.jpg]]
 +
 
 +
Fig. 3 Tobacco leaves transiently expressingGFP, OsAP25-GFPorOsAP37-GFP and were stained by Trypan blue. The dead epidermal cells are indicated by dashed lines and arrows. Bars, 1 cm. Below the leaf images is the western blot analysis of extracts of tobacco leaves transiently expressingGFP, OsAP25-GFPorOsAP37-GFP, using the GFP antibody
  
 
===Evolution===
 
===Evolution===
Line 14: Line 35:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
1. Shanghai Jiao Tong Univ, Sch Life Sci & Biotechnol, State Key Lab Hybrid Rice, Shanghai 200030, Peoples R China
 +
 
 +
 
 +
2. Univ Nottingham, Sch Biosci, Div Plant Sci, Loughborough, Leics, England
 +
 
 +
 
 +
3. Michigan State Univ, Dept Energy, Plant Res Lab, E Lansing, MI 48824 USA
  
 
==References==
 
==References==
Please input cited references here.
+
Ningning Niu;Wanqi Liang;Xijia Yang;Weilin Jin;Zoe A. Wilson;Jianping Hu;Dabing Zhang,''EAT1 promotes tapetal cell death by regulating aspartic proteases during male reproductive development in rice'', Nature Communications, 2013, 4: 1445
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0448500|
 
Description = Peptidase A1, pepsin family protein|
 
Version = NM_001059458.2 GI:297602821 GeneID:4335981|
 
Length = 1658 bp|
 
Definition = Oryza sativa Japonica Group Os04g0448500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:22752236..22753893|
 
CDS = 22752342..22753736|
 
GCID = <gbrowseImage1>
 
name=NC_008397:22752236..22753893
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:22752236..22753893
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaacgccgccgtgttgctgctgctcctcgcgctcgccgccctcccggcgtcgtgcgcgccgccgagatccttccgcctcgagctcgccagcgtcgacgcctcggcagccgacgccgccaacctcacggagcatgagctcctgcggcgcgccatccagcgcagccggtaccggttggccggcatcggcatggcgcgcggcgaggcggccagcgcgcgcaaggccgtcgtggccgagacgcccatcatgccggccggcggcgagtacctggtgaagctcggcatcggcacgccgccgtacaagttcacggcggccatagacaccgccagcgacctcatctggacgcagtgccagccctgcaccggctgctaccaccaggtcgaccccatgttcaaccccagggtgtcctccacctacgccgcgctgccgtgcagcagcgacacgtgcgacgagctggacgtgcaccggtgcggccacgacgacgacgagtcgtgccagtacacctacacgtacagcggcaacgccacgacggagggcaccctggccgtcgacaagctggtcatcggcgaggacgcgttccgcggcgtcgccttcggctgcagcacctccagcaccggcggcgccccgccaccgcaggcgtccggtgtggtcggcctcggccgcggcccactctcgctggtgtcccagctctctgtgcggaggttcgcctactgcctgcccccgccggcgtcgaggatccccgggaagctcgtcctcggcgccgacgccgacgccgcccgcaacgccaccaaccggatcgccgtcccgatgagacgggacccgcggtacccgtcctactactacctcaacctcgacggcctgctcatcggcgacagggcgatgtccctgccgccaacgacgacgacgacggcgacggcgacggcgacggcgccggcgccggcgccgacgccctccccgaacgcgacggcggtcgccgtgggcgacgcgaacaggtacggaatgatcatcgacatcgcgtcgacgatcacgttcctggaggcatcgctgtacgacgagctggtgaacgacctggaggtggagatccggctgccgcgcgggacggggtcaagcctgggcctcgacctgtgcttcatcctgcccgacggcgtggcgttcgaccgggtgtacgtgccggcggtggcgctggcgttcgacgggaggtggctccggctggacaaggcgcggctgttcgcggaggacagggagagcgggatgatgtgcctgatggtggggagggcggaggcgggcagcgtctccatcctcggcaacttccagcagcagaacatgcaggtgctctacaaccttcgccgcggcagggtcaccttcgtccagtccccctgcggcgccctgcgatga</cdnaseq>|
 
AA = <aaseq>MNAAVLLLLLALAALPASCAPPRSFRLELASVDASAADAANLTE                    HELLRRAIQRSRYRLAGIGMARGEAASARKAVVAETPIMPAGGEYLVKLGIGTPPYKF                    TAAIDTASDLIWTQCQPCTGCYHQVDPMFNPRVSSTYAALPCSSDTCDELDVHRCGHD                    DDESCQYTYTYSGNATTEGTLAVDKLVIGEDAFRGVAFGCSTSSTGGAPPPQASGVVG                    LGRGPLSLVSQLSVRRFAYCLPPPASRIPGKLVLGADADAARNATNRIAVPMRRDPRY                    PSYYYLNLDGLLIGDRAMSLPPTTTTTATATATAPAPAPTPSPNATAVAVGDANRYGM                    IIDIASTITFLEASLYDELVNDLEVEIRLPRGTGSSLGLDLCFILPDGVAFDRVYVPA                    VALAFDGRWLRLDKARLFAEDRESGMMCLMVGRAEAGSVSILGNFQQQNMQVLYNLRR                    GRVTFVQSPCGALR</aaseq>|
 
DNA = <dnaseqindica>107..1501#atttcatacgtccgtccaagcgacacccgcccacatgcgtaacgccggcagttgaaccagttcgcggtcacccccactggccagtgggcactgccacgccgcgacgatgaacgccgccgtgttgctgctgctcctcgcgctcgccgccctcccggcgtcgtgcgcgccgccgagatccttccgcctcgagctcgccagcgtcgacgcctcggcagccgacgccgccaacctcacggagcatgagctcctgcggcgcgccatccagcgcagccggtaccggttggccggcatcggcatggcgcgcggcgaggcggccagcgcgcgcaaggccgtcgtggccgagacgcccatcatgccggccggcggcgagtacctggtgaagctcggcatcggcacgccgccgtacaagttcacggcggccatagacaccgccagcgacctcatctggacgcagtgccagccctgcaccggctgctaccaccaggtcgaccccatgttcaaccccagggtgtcctccacctacgccgcgctgccgtgcagcagcgacacgtgcgacgagctggacgtgcaccggtgcggccacgacgacgacgagtcgtgccagtacacctacacgtacagcggcaacgccacgacggagggcaccctggccgtcgacaagctggtcatcggcgaggacgcgttccgcggcgtcgccttcggctgcagcacctccagcaccggcggcgccccgccaccgcaggcgtccggtgtggtcggcctcggccgcggcccactctcgctggtgtcccagctctctgtgcggaggttcgcctactgcctgcccccgccggcgtcgaggatccccgggaagctcgtcctcggcgccgacgccgacgccgcccgcaacgccaccaaccggatcgccgtcccgatgagacgggacccgcggtacccgtcctactactacctcaacctcgacggcctgctcatcggcgacagggcgatgtccctgccgccaacgacgacgacgacggcgacggcgacggcgacggcgccggcgccggcgccgacgccctccccgaacgcgacggcggtcgccgtgggcgacgcgaacaggtacggaatgatcatcgacatcgcgtcgacgatcacgttcctggaggcatcgctgtacgacgagctggtgaacgacctggaggtggagatccggctgccgcgcgggacggggtcaagcctgggcctcgacctgtgcttcatcctgcccgacggcgtggcgttcgaccgggtgtacgtgccggcggtggcgctggcgttcgacgggaggtggctccggctggacaaggcgcggctgttcgcggaggacagggagagcgggatgatgtgcctgatggtggggagggcggaggcgggcagcgtctccatcctcggcaacttccagcagcagaacatgcaggtgctctacaaccttcgccgcggcagggtcaccttcgtccagtccccctgcggcgccctgcgatgagatctctcgtcaccagtatctttgtaaaaccctgcatacatcaattcatcatcatcgtggctggcttatggcctgatgtagttagtgctcatcaacaaattatttggatactcagagatgctttgattagcttgaatcataaaacattttatacgac</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059458.2 RefSeq:Os04g0448500]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:04, 12 June 2015

Please input one-sentence summary here.

Annotated Information

Basic information

Gene name:aspartic protease/ Gene symbol:OsAP37

Function

Programmed cell death is essential for the development of multicellular organisms, yet pathways of plant programmed cell death and its regulation remain elusive. And the OsAP37 and OsAP25, which encode aspartic proteases that induce programmed cell death in both yeast and plants, is regulted directly by ETERNAL TAPETUM1. That is to say ETERNAL TAPETUM 1 promotes aspartic proteases triggering plant programmed cell death, and reveals a dynamic regulatory cascade in male reproductive development in rice.

Expression

Performed microarray analysis of eat1 at stage 9 of anther development , and observed changes in th expression of many genes. SoAP37showed a significant reduction in expression, which was further confirmed by qRT-PCR.

QQ图片20140609141245.jpg

Fig. 1 qRT-PCR analysis of OsAP37


After 4-h 20mM H2O2 treatment, 82% and 71% of the yeast cells overexpressing OsAP25 and OsAP37, respectively, displayed positive signals when labelled with the mammalian caspase substrate FIFC-VAD-fmk, suggesting that OsAP25and OsAP37 share a similar function with YCA1 in promoting PCD process in yeast.

QQ图片20140609142222.jpg

Fig. 2 FITC-VAD-fmk staining showing caspase activities in yeast strains.


Expressed the full-length CDS of OsAP25 or OsAP37 driven by the CAMV 35S promoter in plants. Trypan blue vital staining of tobacco leaves revealed substantially increased death of epidermal and mesophyll cells in leaves transiently expressing OsAP25 and OsAP37 compared with those expressing GFP, or OsAP25 and OsAP37 together with the aspartic protease-specific inhibitor pepstatin A.

QQ图片20140609142833.jpg

Fig. 3 Tobacco leaves transiently expressingGFP, OsAP25-GFPorOsAP37-GFP and were stained by Trypan blue. The dead epidermal cells are indicated by dashed lines and arrows. Bars, 1 cm. Below the leaf images is the western blot analysis of extracts of tobacco leaves transiently expressingGFP, OsAP25-GFPorOsAP37-GFP, using the GFP antibody

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1. Shanghai Jiao Tong Univ, Sch Life Sci & Biotechnol, State Key Lab Hybrid Rice, Shanghai 200030, Peoples R China


2. Univ Nottingham, Sch Biosci, Div Plant Sci, Loughborough, Leics, England


3. Michigan State Univ, Dept Energy, Plant Res Lab, E Lansing, MI 48824 USA

References

Ningning Niu;Wanqi Liang;Xijia Yang;Weilin Jin;Zoe A. Wilson;Jianping Hu;Dabing Zhang,EAT1 promotes tapetal cell death by regulating aspartic proteases during male reproductive development in rice, Nature Communications, 2013, 4: 1445

Structured Information